Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EG76

Protein Details
Accession A0A059EG76   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
83-108LGPVTIKKIGKKRKWVKVSRVNSWIHHydrophilic
NLS Segment(s)
PositionSequence
89-98KKIGKKRKWV
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences EILRIEKGRSLNKIIHKINNRLSSTYNRRIKTIPEDVINGEKLIIKDKLLEKSEVEKNNDMLKIGDKVFVKNFKADKLDYQYLGPVTIKKIGKKRKWVKVSRVNSWIHVKNIKFWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.62
4 0.65
5 0.69
6 0.71
7 0.64
8 0.57
9 0.55
10 0.56
11 0.58
12 0.6
13 0.59
14 0.51
15 0.51
16 0.51
17 0.52
18 0.5
19 0.48
20 0.42
21 0.36
22 0.37
23 0.35
24 0.37
25 0.32
26 0.24
27 0.17
28 0.15
29 0.13
30 0.15
31 0.14
32 0.11
33 0.15
34 0.18
35 0.23
36 0.23
37 0.24
38 0.22
39 0.27
40 0.33
41 0.34
42 0.34
43 0.29
44 0.29
45 0.31
46 0.3
47 0.25
48 0.18
49 0.16
50 0.15
51 0.14
52 0.16
53 0.14
54 0.15
55 0.19
56 0.23
57 0.23
58 0.26
59 0.26
60 0.26
61 0.28
62 0.28
63 0.29
64 0.32
65 0.34
66 0.3
67 0.29
68 0.28
69 0.25
70 0.25
71 0.21
72 0.14
73 0.14
74 0.2
75 0.23
76 0.27
77 0.36
78 0.46
79 0.53
80 0.63
81 0.71
82 0.74
83 0.82
84 0.85
85 0.87
86 0.87
87 0.87
88 0.84
89 0.81
90 0.73
91 0.68
92 0.68
93 0.62
94 0.57
95 0.57
96 0.5