Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EFS5

Protein Details
Accession A0A059EFS5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-45MVRKKRQSKRISTKKRVKIAKNVTAHKRKERRNAKKTNKDRIRAPBasic
NLS Segment(s)
PositionSequence
3-43RKKRQSKRISTKKRVKIAKNVTAHKRKERRNAKKTNKDRIR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR014813  Gnl3_N_dom  
Pfam View protein in Pfam  
PF08701  GN3L_Grn1  
Amino Acid Sequences MVRKKRQSKRISTKKRVKIAKNVTAHKRKERRNAKKTNKDRIRAPPSIFFTEEEKKSLAEIKRNTLIRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.89
4 0.84
5 0.84
6 0.82
7 0.8
8 0.77
9 0.76
10 0.77
11 0.76
12 0.75
13 0.74
14 0.73
15 0.72
16 0.75
17 0.78
18 0.79
19 0.81
20 0.86
21 0.87
22 0.89
23 0.9
24 0.91
25 0.88
26 0.81
27 0.78
28 0.77
29 0.74
30 0.69
31 0.63
32 0.59
33 0.56
34 0.55
35 0.49
36 0.4
37 0.38
38 0.4
39 0.38
40 0.33
41 0.28
42 0.24
43 0.24
44 0.3
45 0.29
46 0.31
47 0.34
48 0.39
49 0.47