Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EKG0

Protein Details
Accession A0A059EKG0    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-42NRSTIQNDKSTPKRKKRKLWPVFWRLCSIHydrophilic
NLS Segment(s)
PositionSequence
25-31PKRKKRK
Subcellular Location(s) mito 9plas 9, mito_nucl 8.833, nucl 7.5, cyto_mito 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR004835  Chitin_synth  
Gene Ontology GO:0016020  C:membrane  
GO:0004100  F:chitin synthase activity  
Amino Acid Sequences MRRQSHAQMIRSINRSTIQNDKSTPKRKKRKLWPVFWRLCSILIPNFVLSCFGMKTEEVRNAWREKFALCCVIFLCCCGLAFLTYGMNLIVCKSSNQYVYQFINRAKFKKQTIIANGKVNYISNSCKADIKKSNKNMTHCFNIKSGACKKAFGGGVVGSGPYKLKNSDIIPIAPIHYTWKDIKDNGYIVIDNKVYDPSENIEGDLKEFISQAKGTDASDLAKEMLEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.38
4 0.41
5 0.37
6 0.38
7 0.42
8 0.47
9 0.54
10 0.62
11 0.68
12 0.7
13 0.77
14 0.82
15 0.88
16 0.91
17 0.93
18 0.93
19 0.93
20 0.93
21 0.93
22 0.91
23 0.83
24 0.77
25 0.66
26 0.57
27 0.48
28 0.4
29 0.32
30 0.26
31 0.24
32 0.2
33 0.19
34 0.17
35 0.17
36 0.14
37 0.12
38 0.09
39 0.09
40 0.09
41 0.09
42 0.12
43 0.15
44 0.21
45 0.21
46 0.24
47 0.28
48 0.32
49 0.33
50 0.32
51 0.29
52 0.24
53 0.26
54 0.25
55 0.28
56 0.23
57 0.22
58 0.21
59 0.22
60 0.21
61 0.17
62 0.16
63 0.09
64 0.09
65 0.08
66 0.08
67 0.06
68 0.07
69 0.07
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.07
81 0.1
82 0.12
83 0.14
84 0.15
85 0.18
86 0.2
87 0.22
88 0.23
89 0.23
90 0.29
91 0.3
92 0.31
93 0.31
94 0.35
95 0.34
96 0.37
97 0.39
98 0.38
99 0.42
100 0.48
101 0.47
102 0.47
103 0.45
104 0.39
105 0.35
106 0.3
107 0.23
108 0.18
109 0.16
110 0.14
111 0.15
112 0.15
113 0.19
114 0.19
115 0.25
116 0.33
117 0.38
118 0.45
119 0.51
120 0.59
121 0.6
122 0.65
123 0.64
124 0.59
125 0.59
126 0.53
127 0.47
128 0.39
129 0.38
130 0.33
131 0.35
132 0.35
133 0.34
134 0.32
135 0.31
136 0.3
137 0.32
138 0.31
139 0.24
140 0.22
141 0.15
142 0.15
143 0.14
144 0.14
145 0.08
146 0.08
147 0.08
148 0.07
149 0.09
150 0.09
151 0.1
152 0.15
153 0.16
154 0.21
155 0.23
156 0.22
157 0.22
158 0.22
159 0.21
160 0.17
161 0.16
162 0.16
163 0.14
164 0.17
165 0.19
166 0.23
167 0.26
168 0.28
169 0.31
170 0.31
171 0.31
172 0.29
173 0.28
174 0.24
175 0.21
176 0.23
177 0.21
178 0.16
179 0.16
180 0.16
181 0.15
182 0.15
183 0.15
184 0.15
185 0.19
186 0.19
187 0.19
188 0.2
189 0.2
190 0.21
191 0.2
192 0.17
193 0.13
194 0.13
195 0.13
196 0.13
197 0.13
198 0.13
199 0.15
200 0.16
201 0.16
202 0.18
203 0.18
204 0.16
205 0.17
206 0.17
207 0.14
208 0.14