Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EUW0

Protein Details
Accession A0A059EUW0   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
197-226NSRYRFFCPHPSCNKKFKTKNGFKYHIESKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MVDKEGKCSCYLNAEIKGVKNFYCRCECHSYSNFGYYTFEESLLGSKICKNTDEEINLNDKIAYQRQDKIGYDINKIYFNRLDTSTNNLEMKEYWHNINDHDQSMEITKNNDDLYCNPNLNFLYTNLKITSLSFNDYIFNIKNRLVSKHMYAGITFYEYYNTIDGTLFFCGNINCKKKYTTRNGIIYHIESGCRNKNSRYRFFCPHPSCNKKFKTKNGFKYHIESKHYRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.4
4 0.43
5 0.38
6 0.36
7 0.37
8 0.37
9 0.38
10 0.43
11 0.42
12 0.44
13 0.51
14 0.52
15 0.53
16 0.54
17 0.54
18 0.49
19 0.52
20 0.46
21 0.37
22 0.37
23 0.29
24 0.3
25 0.24
26 0.21
27 0.16
28 0.16
29 0.17
30 0.17
31 0.15
32 0.11
33 0.14
34 0.17
35 0.18
36 0.19
37 0.2
38 0.23
39 0.29
40 0.32
41 0.3
42 0.3
43 0.33
44 0.32
45 0.28
46 0.24
47 0.19
48 0.18
49 0.2
50 0.22
51 0.21
52 0.25
53 0.28
54 0.33
55 0.32
56 0.33
57 0.36
58 0.34
59 0.35
60 0.33
61 0.31
62 0.32
63 0.32
64 0.31
65 0.25
66 0.24
67 0.24
68 0.23
69 0.24
70 0.2
71 0.26
72 0.25
73 0.26
74 0.25
75 0.22
76 0.21
77 0.18
78 0.21
79 0.19
80 0.19
81 0.17
82 0.19
83 0.19
84 0.2
85 0.26
86 0.25
87 0.2
88 0.19
89 0.18
90 0.15
91 0.16
92 0.16
93 0.11
94 0.1
95 0.09
96 0.1
97 0.11
98 0.1
99 0.1
100 0.11
101 0.13
102 0.14
103 0.15
104 0.13
105 0.15
106 0.15
107 0.15
108 0.14
109 0.12
110 0.16
111 0.16
112 0.18
113 0.15
114 0.16
115 0.15
116 0.15
117 0.17
118 0.12
119 0.14
120 0.13
121 0.13
122 0.14
123 0.14
124 0.15
125 0.13
126 0.13
127 0.13
128 0.13
129 0.17
130 0.18
131 0.21
132 0.22
133 0.23
134 0.24
135 0.27
136 0.28
137 0.25
138 0.23
139 0.21
140 0.18
141 0.18
142 0.16
143 0.11
144 0.09
145 0.1
146 0.11
147 0.1
148 0.1
149 0.09
150 0.09
151 0.09
152 0.09
153 0.1
154 0.09
155 0.08
156 0.09
157 0.09
158 0.14
159 0.22
160 0.26
161 0.27
162 0.29
163 0.34
164 0.41
165 0.51
166 0.56
167 0.58
168 0.61
169 0.67
170 0.68
171 0.68
172 0.63
173 0.55
174 0.48
175 0.39
176 0.31
177 0.25
178 0.29
179 0.32
180 0.33
181 0.34
182 0.38
183 0.46
184 0.54
185 0.62
186 0.65
187 0.64
188 0.68
189 0.72
190 0.76
191 0.75
192 0.76
193 0.77
194 0.78
195 0.78
196 0.8
197 0.81
198 0.81
199 0.82
200 0.83
201 0.84
202 0.84
203 0.88
204 0.88
205 0.87
206 0.81
207 0.8
208 0.79
209 0.76
210 0.72