Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EFZ6

Protein Details
Accession A0A059EFZ6    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
37-62RFYCKKCLYVPNKKEHKNKDCVNCLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS50114  GATA_ZN_FINGER_2  
Amino Acid Sequences NFYCSSCKVSVTMYWRDGWEENILLCNKCGLRFEKIRFYCKKCLYVPNKKEHKNKDCVNCLFEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.32
4 0.3
5 0.26
6 0.23
7 0.17
8 0.15
9 0.18
10 0.19
11 0.16
12 0.16
13 0.16
14 0.14
15 0.14
16 0.17
17 0.15
18 0.19
19 0.25
20 0.28
21 0.36
22 0.39
23 0.46
24 0.5
25 0.53
26 0.57
27 0.56
28 0.59
29 0.53
30 0.6
31 0.62
32 0.66
33 0.68
34 0.7
35 0.75
36 0.78
37 0.83
38 0.84
39 0.83
40 0.82
41 0.82
42 0.82
43 0.82
44 0.77