Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EP37

Protein Details
Accession A0A059EP37    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
50-77ESSNSMKRENLKQKKDKSKYKSKIIFYLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, mito_nucl 10, cyto 5
Family & Domain DBs
Amino Acid Sequences MYDWFKSNGYQPKEVIKKLRQEKVSGEFKILFYSEDSDIEKIINNLKDWESSNSMKRENLKQKKDKSKYKSKIIFYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.55
3 0.52
4 0.56
5 0.61
6 0.67
7 0.6
8 0.56
9 0.57
10 0.56
11 0.58
12 0.48
13 0.43
14 0.36
15 0.34
16 0.32
17 0.27
18 0.19
19 0.12
20 0.14
21 0.12
22 0.11
23 0.12
24 0.11
25 0.11
26 0.1
27 0.1
28 0.08
29 0.11
30 0.12
31 0.11
32 0.13
33 0.13
34 0.15
35 0.17
36 0.2
37 0.21
38 0.23
39 0.28
40 0.3
41 0.32
42 0.33
43 0.36
44 0.43
45 0.49
46 0.56
47 0.61
48 0.67
49 0.75
50 0.83
51 0.89
52 0.89
53 0.87
54 0.88
55 0.87
56 0.88
57 0.87