Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059ELB0

Protein Details
Accession A0A059ELB0    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
67-86GKIRAMKPCKTKKYVNNWADHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 9, cyto 8, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036134  Crypto/Photolyase_FAD-like_sf  
Amino Acid Sequences KMHGYVRMYWAKTLLQWSKTPEEALERAFYLNDKYSIDGNDPNGYLGIMWSICGSMDQGWAEREIIGKIRAMKPCKTKKYVNNWADKNIESYIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.33
4 0.37
5 0.39
6 0.39
7 0.38
8 0.3
9 0.29
10 0.27
11 0.26
12 0.22
13 0.18
14 0.17
15 0.17
16 0.16
17 0.14
18 0.14
19 0.13
20 0.12
21 0.13
22 0.14
23 0.14
24 0.16
25 0.15
26 0.15
27 0.15
28 0.14
29 0.13
30 0.12
31 0.11
32 0.08
33 0.06
34 0.05
35 0.03
36 0.04
37 0.03
38 0.03
39 0.03
40 0.04
41 0.04
42 0.04
43 0.06
44 0.06
45 0.07
46 0.08
47 0.08
48 0.09
49 0.08
50 0.09
51 0.09
52 0.11
53 0.11
54 0.12
55 0.17
56 0.22
57 0.29
58 0.33
59 0.39
60 0.47
61 0.56
62 0.63
63 0.64
64 0.68
65 0.71
66 0.77
67 0.82
68 0.8
69 0.8
70 0.75
71 0.74
72 0.69
73 0.6
74 0.53