Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EL09

Protein Details
Accession A0A059EL09    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-33GAFINKNKKIKYKNSSKKKTKKIGDEGLEHydrophilic
NLS Segment(s)
PositionSequence
10-26KNKKIKYKNSSKKKTKK
Subcellular Location(s) mito 10.5, mito_nucl 10.166, cyto_nucl 9.333, nucl 8.5, cyto 8
Family & Domain DBs
Amino Acid Sequences MSIFGAFINKNKKIKYKNSSKKKTKKIGDEGLEVQIDEVAICNSFIVKNPSFTLDDKKMYNGLLAELIVLKVKIFFKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.68
3 0.71
4 0.75
5 0.81
6 0.88
7 0.9
8 0.92
9 0.92
10 0.92
11 0.89
12 0.88
13 0.85
14 0.83
15 0.76
16 0.7
17 0.61
18 0.53
19 0.44
20 0.34
21 0.25
22 0.16
23 0.12
24 0.07
25 0.05
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.04
32 0.06
33 0.11
34 0.12
35 0.14
36 0.15
37 0.18
38 0.2
39 0.21
40 0.27
41 0.26
42 0.28
43 0.28
44 0.29
45 0.27
46 0.25
47 0.25
48 0.18
49 0.15
50 0.12
51 0.11
52 0.1
53 0.09
54 0.09
55 0.09
56 0.08
57 0.07
58 0.1