Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ESP6

Protein Details
Accession A0A059ESP6   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MLNHKCKDHRGRLPQNKTDALHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024445  Tnp_ISXO2-like  
Pfam View protein in Pfam  
PF12762  DDE_Tnp_IS1595  
Amino Acid Sequences MLNHKCKDHRGRLPQNKTDALCIVEVGNQITRAFATVIENKKSEHIMPIICSQVASGSIVWTDEHKSYASSYKNSFIYNIVCHKYEFVNKDDGTNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.78
4 0.69
5 0.61
6 0.51
7 0.42
8 0.32
9 0.25
10 0.19
11 0.15
12 0.14
13 0.12
14 0.12
15 0.11
16 0.11
17 0.1
18 0.1
19 0.09
20 0.08
21 0.07
22 0.1
23 0.16
24 0.2
25 0.22
26 0.23
27 0.22
28 0.23
29 0.24
30 0.21
31 0.16
32 0.14
33 0.13
34 0.14
35 0.15
36 0.15
37 0.13
38 0.13
39 0.1
40 0.08
41 0.08
42 0.07
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.07
49 0.09
50 0.09
51 0.1
52 0.1
53 0.11
54 0.12
55 0.18
56 0.2
57 0.22
58 0.24
59 0.28
60 0.29
61 0.29
62 0.29
63 0.25
64 0.25
65 0.26
66 0.3
67 0.29
68 0.28
69 0.28
70 0.28
71 0.3
72 0.35
73 0.33
74 0.3
75 0.35
76 0.35