Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ENW8

Protein Details
Accession A0A059ENW8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-39AGKNVEKNKLKKKIAKSNHGVHydrophilic
NLS Segment(s)
PositionSequence
29-30KK
Subcellular Location(s) cyto 18, cyto_nucl 13, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
Amino Acid Sequences MEEEAAKHEIPFISFETVAGKNVEKNKLKKKIAKSNHGVITLTNFNRFFEISFFNRKRTPLYFYKPGTDLKTCYEEISRTCKFKLRNNTVLSFAAGYVELGEEKILQNVQAGLDFFVTLLKKGVSNIASVNIKSNQSKAIKLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.19
4 0.19
5 0.2
6 0.19
7 0.18
8 0.19
9 0.26
10 0.35
11 0.38
12 0.46
13 0.55
14 0.63
15 0.7
16 0.74
17 0.78
18 0.79
19 0.81
20 0.83
21 0.79
22 0.77
23 0.74
24 0.67
25 0.57
26 0.47
27 0.42
28 0.38
29 0.33
30 0.28
31 0.23
32 0.22
33 0.23
34 0.23
35 0.18
36 0.14
37 0.18
38 0.17
39 0.27
40 0.28
41 0.31
42 0.33
43 0.33
44 0.35
45 0.33
46 0.36
47 0.33
48 0.39
49 0.43
50 0.43
51 0.44
52 0.42
53 0.42
54 0.39
55 0.33
56 0.27
57 0.22
58 0.24
59 0.22
60 0.2
61 0.19
62 0.16
63 0.17
64 0.23
65 0.23
66 0.21
67 0.22
68 0.26
69 0.29
70 0.35
71 0.44
72 0.45
73 0.51
74 0.53
75 0.54
76 0.52
77 0.49
78 0.42
79 0.31
80 0.23
81 0.15
82 0.11
83 0.09
84 0.06
85 0.05
86 0.04
87 0.04
88 0.04
89 0.05
90 0.05
91 0.06
92 0.06
93 0.06
94 0.07
95 0.08
96 0.08
97 0.08
98 0.09
99 0.08
100 0.08
101 0.08
102 0.07
103 0.1
104 0.1
105 0.09
106 0.1
107 0.1
108 0.1
109 0.11
110 0.17
111 0.14
112 0.16
113 0.16
114 0.21
115 0.24
116 0.23
117 0.28
118 0.26
119 0.3
120 0.3
121 0.31
122 0.33
123 0.33