Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EGY2

Protein Details
Accession A0A059EGY2    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20IFRKLKNKIKFTRKRLCLIPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences IFRKLKNKIKFTRKRLCLIPQERNVAEKMDYRAFYATEISRISDCNLVLLNESGFNEHTRRVYGYSPINTKAYLTVPGIKNLNRSLLYMIGVRYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.76
4 0.76
5 0.74
6 0.74
7 0.69
8 0.7
9 0.64
10 0.59
11 0.51
12 0.42
13 0.34
14 0.29
15 0.27
16 0.24
17 0.24
18 0.23
19 0.23
20 0.22
21 0.2
22 0.19
23 0.15
24 0.13
25 0.13
26 0.13
27 0.12
28 0.12
29 0.13
30 0.12
31 0.11
32 0.1
33 0.1
34 0.09
35 0.09
36 0.09
37 0.07
38 0.06
39 0.06
40 0.07
41 0.07
42 0.08
43 0.09
44 0.1
45 0.11
46 0.11
47 0.12
48 0.14
49 0.15
50 0.19
51 0.24
52 0.27
53 0.3
54 0.32
55 0.31
56 0.29
57 0.28
58 0.25
59 0.21
60 0.19
61 0.18
62 0.23
63 0.23
64 0.27
65 0.31
66 0.3
67 0.33
68 0.32
69 0.36
70 0.29
71 0.29
72 0.27
73 0.25
74 0.25
75 0.22