Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ETR8

Protein Details
Accession A0A059ETR8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
52-82NESVCKVVRKESKKKNKNKIMNNKNNNEFNKHydrophilic
NLS Segment(s)
PositionSequence
61-68KESKKKNK
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences YLTETGTDNELAMIYLEGLSVIIKSTTNELTMNNNLNINNESVIKNESIISNESVCKVVRKESKKKNKNKIMNNKNNNEFNKLSNEMNIINLNNNIISNEINNINIFNNVKLSFDVSFYNRMILLLNKNDISIINRLLNNNINLNINILIEVINHLICKECICNNYEESMFISLKLLKQNHLFIKLINDNIKEVNDDLFDKLSTVLLCLIFNEEKSELQSLILDLLISLINSNNTKVLSIKSIIYLYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.04
8 0.05
9 0.05
10 0.06
11 0.07
12 0.11
13 0.12
14 0.13
15 0.14
16 0.15
17 0.2
18 0.25
19 0.28
20 0.26
21 0.27
22 0.26
23 0.27
24 0.27
25 0.23
26 0.19
27 0.17
28 0.16
29 0.15
30 0.17
31 0.15
32 0.14
33 0.14
34 0.14
35 0.14
36 0.15
37 0.16
38 0.16
39 0.16
40 0.17
41 0.17
42 0.17
43 0.18
44 0.17
45 0.24
46 0.31
47 0.4
48 0.49
49 0.59
50 0.7
51 0.76
52 0.85
53 0.88
54 0.9
55 0.9
56 0.9
57 0.91
58 0.91
59 0.92
60 0.91
61 0.87
62 0.83
63 0.82
64 0.73
65 0.67
66 0.57
67 0.48
68 0.44
69 0.39
70 0.33
71 0.26
72 0.25
73 0.2
74 0.2
75 0.19
76 0.14
77 0.12
78 0.12
79 0.11
80 0.1
81 0.09
82 0.08
83 0.07
84 0.07
85 0.06
86 0.08
87 0.08
88 0.08
89 0.08
90 0.09
91 0.08
92 0.1
93 0.1
94 0.08
95 0.1
96 0.1
97 0.11
98 0.1
99 0.11
100 0.1
101 0.1
102 0.12
103 0.11
104 0.14
105 0.13
106 0.14
107 0.12
108 0.11
109 0.11
110 0.11
111 0.13
112 0.11
113 0.12
114 0.12
115 0.12
116 0.12
117 0.11
118 0.12
119 0.11
120 0.11
121 0.13
122 0.14
123 0.14
124 0.16
125 0.18
126 0.17
127 0.17
128 0.16
129 0.14
130 0.13
131 0.14
132 0.12
133 0.1
134 0.09
135 0.07
136 0.06
137 0.05
138 0.06
139 0.06
140 0.05
141 0.05
142 0.05
143 0.06
144 0.06
145 0.07
146 0.09
147 0.11
148 0.12
149 0.14
150 0.17
151 0.17
152 0.19
153 0.18
154 0.17
155 0.16
156 0.18
157 0.16
158 0.14
159 0.14
160 0.13
161 0.15
162 0.21
163 0.2
164 0.2
165 0.23
166 0.3
167 0.32
168 0.35
169 0.33
170 0.27
171 0.34
172 0.33
173 0.34
174 0.32
175 0.29
176 0.27
177 0.28
178 0.27
179 0.21
180 0.19
181 0.16
182 0.13
183 0.14
184 0.14
185 0.13
186 0.13
187 0.12
188 0.12
189 0.12
190 0.1
191 0.1
192 0.11
193 0.1
194 0.1
195 0.1
196 0.14
197 0.14
198 0.14
199 0.16
200 0.16
201 0.15
202 0.18
203 0.2
204 0.15
205 0.15
206 0.15
207 0.12
208 0.12
209 0.11
210 0.08
211 0.06
212 0.07
213 0.07
214 0.06
215 0.06
216 0.06
217 0.1
218 0.11
219 0.13
220 0.14
221 0.14
222 0.15
223 0.17
224 0.18
225 0.19
226 0.2
227 0.21
228 0.22