Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ETZ0

Protein Details
Accession A0A059ETZ0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
180-215VPNQKEKNLISKLKKKYKKFEKYKKNLKNIIVKLNIHydrophilic
NLS Segment(s)
PositionSequence
190-204SKLKKKYKKFEKYKK
Subcellular Location(s) cyto 10.5cyto_nucl 10.5, nucl 9.5, mito 4
Family & Domain DBs
Amino Acid Sequences MNQKNLILNLCLFIFDLVFCSNKYQVINDSESTSENSNNISDVINDYKEALVKVFIENFDILTPLIYNFEELEESKSLVSKKENLQLKDIFLVLFNKKVEFKYWYDPSLDLICLKHKALEGIKIQDNNVKELIPKINKLIEILNKLFLRSKEINSILIDLFDEIKLTRTKDGTLTDNEIVPNQKEKNLISKLKKKYKKFEKYKKNLKNIIVKLNISVYKYLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.1
4 0.09
5 0.11
6 0.11
7 0.14
8 0.15
9 0.18
10 0.19
11 0.19
12 0.23
13 0.27
14 0.3
15 0.27
16 0.28
17 0.26
18 0.27
19 0.27
20 0.23
21 0.19
22 0.16
23 0.16
24 0.14
25 0.14
26 0.13
27 0.11
28 0.1
29 0.13
30 0.15
31 0.14
32 0.14
33 0.14
34 0.14
35 0.15
36 0.15
37 0.12
38 0.1
39 0.1
40 0.11
41 0.12
42 0.12
43 0.13
44 0.12
45 0.12
46 0.11
47 0.11
48 0.09
49 0.07
50 0.08
51 0.06
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.08
58 0.08
59 0.11
60 0.1
61 0.11
62 0.1
63 0.13
64 0.13
65 0.14
66 0.16
67 0.18
68 0.21
69 0.28
70 0.35
71 0.34
72 0.38
73 0.37
74 0.36
75 0.32
76 0.28
77 0.2
78 0.15
79 0.17
80 0.13
81 0.15
82 0.14
83 0.14
84 0.15
85 0.16
86 0.17
87 0.18
88 0.2
89 0.24
90 0.27
91 0.27
92 0.27
93 0.26
94 0.26
95 0.23
96 0.2
97 0.14
98 0.12
99 0.12
100 0.12
101 0.12
102 0.11
103 0.1
104 0.13
105 0.13
106 0.18
107 0.19
108 0.21
109 0.24
110 0.23
111 0.23
112 0.24
113 0.24
114 0.2
115 0.18
116 0.14
117 0.12
118 0.14
119 0.2
120 0.19
121 0.2
122 0.2
123 0.21
124 0.21
125 0.22
126 0.23
127 0.21
128 0.24
129 0.24
130 0.27
131 0.25
132 0.26
133 0.28
134 0.25
135 0.28
136 0.26
137 0.27
138 0.28
139 0.29
140 0.31
141 0.28
142 0.3
143 0.22
144 0.2
145 0.18
146 0.11
147 0.11
148 0.08
149 0.08
150 0.06
151 0.09
152 0.11
153 0.13
154 0.15
155 0.16
156 0.17
157 0.2
158 0.23
159 0.24
160 0.26
161 0.3
162 0.28
163 0.28
164 0.27
165 0.26
166 0.25
167 0.23
168 0.26
169 0.22
170 0.24
171 0.25
172 0.27
173 0.34
174 0.4
175 0.47
176 0.51
177 0.59
178 0.66
179 0.74
180 0.82
181 0.82
182 0.84
183 0.87
184 0.88
185 0.9
186 0.9
187 0.91
188 0.93
189 0.95
190 0.95
191 0.94
192 0.91
193 0.88
194 0.87
195 0.82
196 0.81
197 0.75
198 0.66
199 0.58
200 0.56
201 0.51
202 0.42