Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EG39

Protein Details
Accession A0A059EG39    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-53NSNEKKNIKKTKEKLNKINKKIEKNNLKSNKKENKEKDKKDKKELKSLKKAHKBasic
NLS Segment(s)
PositionSequence
5-78KKNIKKTKEKLNKINKKIEKNNLKSNKKENKEKDKKDKKELKSLKKAHKLIFKLSLKNKIKNKEIFKRDKNKII
Subcellular Location(s) nucl 15, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences NSNEKKNIKKTKEKLNKINKKIEKNNLKSNKKENKEKDKKDKKELKSLKKAHKLIFKLSLKNKIKNKEIFKRDKNKIIKYYKDKVKSITKLNDYYLLVQTDIFNSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.86
5 0.89
6 0.86
7 0.85
8 0.84
9 0.84
10 0.84
11 0.8
12 0.83
13 0.82
14 0.81
15 0.77
16 0.79
17 0.79
18 0.76
19 0.79
20 0.78
21 0.79
22 0.83
23 0.86
24 0.87
25 0.88
26 0.87
27 0.88
28 0.88
29 0.81
30 0.81
31 0.81
32 0.8
33 0.79
34 0.8
35 0.79
36 0.79
37 0.78
38 0.72
39 0.7
40 0.62
41 0.55
42 0.56
43 0.5
44 0.47
45 0.47
46 0.52
47 0.5
48 0.56
49 0.58
50 0.56
51 0.59
52 0.61
53 0.65
54 0.65
55 0.69
56 0.72
57 0.75
58 0.78
59 0.77
60 0.79
61 0.79
62 0.77
63 0.77
64 0.76
65 0.76
66 0.74
67 0.78
68 0.77
69 0.76
70 0.7
71 0.67
72 0.69
73 0.66
74 0.66
75 0.65
76 0.63
77 0.59
78 0.59
79 0.58
80 0.49
81 0.46
82 0.41
83 0.33
84 0.27
85 0.24
86 0.22