Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ELJ8

Protein Details
Accession A0A059ELJ8   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
68-87EYLLLRTRKISKRMRINMDFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036224  GINS_bundle-like_dom_sf  
Gene Ontology GO:0006260  P:DNA replication  
Amino Acid Sequences MKSALETLITNYQNEKNTEEILPYATEVVDFYKSAIPNHINFMSTTKNTILRSILEQEIERAKYFLKEYLLLRTRKISKRMRINMDFLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.26
4 0.27
5 0.27
6 0.24
7 0.2
8 0.17
9 0.15
10 0.13
11 0.11
12 0.09
13 0.08
14 0.07
15 0.08
16 0.08
17 0.07
18 0.08
19 0.12
20 0.12
21 0.13
22 0.17
23 0.17
24 0.17
25 0.21
26 0.2
27 0.17
28 0.17
29 0.18
30 0.18
31 0.16
32 0.17
33 0.14
34 0.17
35 0.17
36 0.18
37 0.17
38 0.15
39 0.17
40 0.18
41 0.18
42 0.15
43 0.15
44 0.16
45 0.19
46 0.2
47 0.18
48 0.15
49 0.15
50 0.16
51 0.17
52 0.18
53 0.16
54 0.19
55 0.2
56 0.3
57 0.36
58 0.35
59 0.35
60 0.4
61 0.47
62 0.51
63 0.59
64 0.59
65 0.62
66 0.72
67 0.79
68 0.81
69 0.77