Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EJ93

Protein Details
Accession A0A059EJ93    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-95KLEEETKEREKNRKKKKNSEEKKKKIKKTVEVNSDEIEAKNKKKSKKSSKKKEEPKEEKIKKTBasic
NLS Segment(s)
PositionSequence
39-62KEREKNRKKKKNSEEKKKKIKKTV
70-95EAKNKKKSKKSSKKKEEPKEEKIKKT
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences LSNFFSSIFRSCRREKEEETDTSPVNYLSEISKLEEETKEREKNRKKKKNSEEKKKKIKKTVEVNSDEIEAKNKKKSKKSSKKKEEPKEEKIKKTVVNKTKNKTIPSIEDSFFGSAEDHNYTPFQNKKLYLDQEIHLKERNKYNSGFTDYSYIIDKYIVNPYEKIDHNHLQSKEISVMLKNKMEEYIKNNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.62
4 0.64
5 0.63
6 0.63
7 0.57
8 0.5
9 0.44
10 0.39
11 0.3
12 0.23
13 0.17
14 0.13
15 0.1
16 0.12
17 0.12
18 0.13
19 0.14
20 0.15
21 0.18
22 0.2
23 0.21
24 0.25
25 0.32
26 0.37
27 0.41
28 0.5
29 0.58
30 0.66
31 0.74
32 0.79
33 0.81
34 0.85
35 0.91
36 0.92
37 0.93
38 0.94
39 0.94
40 0.94
41 0.95
42 0.94
43 0.92
44 0.9
45 0.88
46 0.86
47 0.85
48 0.84
49 0.82
50 0.76
51 0.69
52 0.6
53 0.53
54 0.44
55 0.34
56 0.29
57 0.24
58 0.22
59 0.27
60 0.32
61 0.37
62 0.45
63 0.56
64 0.62
65 0.7
66 0.79
67 0.82
68 0.89
69 0.92
70 0.94
71 0.93
72 0.93
73 0.9
74 0.89
75 0.88
76 0.84
77 0.78
78 0.71
79 0.65
80 0.58
81 0.58
82 0.57
83 0.55
84 0.58
85 0.61
86 0.62
87 0.66
88 0.66
89 0.59
90 0.54
91 0.48
92 0.43
93 0.4
94 0.4
95 0.32
96 0.28
97 0.27
98 0.24
99 0.21
100 0.16
101 0.11
102 0.07
103 0.09
104 0.1
105 0.09
106 0.1
107 0.1
108 0.11
109 0.16
110 0.19
111 0.2
112 0.22
113 0.23
114 0.27
115 0.33
116 0.36
117 0.34
118 0.34
119 0.33
120 0.37
121 0.38
122 0.35
123 0.34
124 0.34
125 0.34
126 0.4
127 0.44
128 0.4
129 0.39
130 0.42
131 0.42
132 0.46
133 0.43
134 0.35
135 0.34
136 0.3
137 0.3
138 0.27
139 0.22
140 0.15
141 0.15
142 0.15
143 0.13
144 0.2
145 0.22
146 0.21
147 0.22
148 0.24
149 0.29
150 0.31
151 0.34
152 0.33
153 0.37
154 0.41
155 0.48
156 0.46
157 0.43
158 0.42
159 0.4
160 0.35
161 0.3
162 0.27
163 0.23
164 0.28
165 0.3
166 0.33
167 0.31
168 0.3
169 0.34
170 0.35
171 0.35
172 0.37