Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EW42

Protein Details
Accession A0A059EW42   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22LNLKREEKKETKKERDNFTNKVHydrophilic
NLS Segment(s)
PositionSequence
96-100SKAKK
Subcellular Location(s) nucl 14.5cyto_nucl 14.5, cyto 9.5
Family & Domain DBs
Amino Acid Sequences LNLKREEKKETKKERDNFTNKVYTFACDVPLQIKDIKKAFDDVAFVDIKSKCLRFKNTKDFEEKEIVYEDKTIQVKKMDEEGVKKYLSEINSFKKSKAKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.85
4 0.79
5 0.75
6 0.72
7 0.62
8 0.59
9 0.49
10 0.4
11 0.36
12 0.3
13 0.26
14 0.18
15 0.18
16 0.16
17 0.16
18 0.16
19 0.17
20 0.18
21 0.2
22 0.22
23 0.23
24 0.21
25 0.23
26 0.22
27 0.19
28 0.18
29 0.14
30 0.14
31 0.13
32 0.12
33 0.15
34 0.14
35 0.14
36 0.15
37 0.16
38 0.17
39 0.22
40 0.3
41 0.34
42 0.43
43 0.52
44 0.58
45 0.6
46 0.63
47 0.61
48 0.57
49 0.53
50 0.44
51 0.35
52 0.31
53 0.27
54 0.21
55 0.2
56 0.16
57 0.17
58 0.2
59 0.19
60 0.19
61 0.22
62 0.23
63 0.24
64 0.28
65 0.27
66 0.28
67 0.31
68 0.33
69 0.33
70 0.32
71 0.3
72 0.27
73 0.27
74 0.25
75 0.27
76 0.29
77 0.34
78 0.43
79 0.45
80 0.45
81 0.5