Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ENM7

Protein Details
Accession A0A059ENM7   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
119-138ATPKLIRLKRDKKRNFNGDVHydrophilic
183-205LLNLKREEKKETKKERDNFTNKVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 14, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR045180  La_dom_prot  
IPR006630  La_HTH  
IPR002344  Lupus_La  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF05383  La  
PROSITE View protein in PROSITE  
PS50961  HTH_LA  
Amino Acid Sequences MSLSKEEIKNQIEFYFSDSNYRIDTFLKTTCALDDGYIPISTICKFKNLSTNKVDEEQVKEACKDSKVVEIKDNKIKKIITPEYQEYLKINPEENIVGIRGFDKKMTLKDIQLFLQDYATPKLIRLKRDKKRNFNGDVLVELASKEEVEKMLGMKIKLDSNENEPKKLKTEEDFLQIMTKNELLNLKREEKKETKKERDNFTNKVYTFTCDVPLQIKDIKKAFDDVAFVDIKSKCLRFKNTKDFEEKEIVYEDKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.26
4 0.29
5 0.28
6 0.29
7 0.29
8 0.3
9 0.25
10 0.2
11 0.23
12 0.21
13 0.22
14 0.23
15 0.22
16 0.22
17 0.21
18 0.21
19 0.18
20 0.15
21 0.14
22 0.13
23 0.14
24 0.13
25 0.12
26 0.11
27 0.12
28 0.13
29 0.15
30 0.14
31 0.16
32 0.18
33 0.21
34 0.31
35 0.35
36 0.41
37 0.42
38 0.46
39 0.45
40 0.46
41 0.45
42 0.39
43 0.38
44 0.36
45 0.33
46 0.3
47 0.28
48 0.28
49 0.28
50 0.25
51 0.22
52 0.19
53 0.25
54 0.28
55 0.3
56 0.35
57 0.39
58 0.44
59 0.51
60 0.53
61 0.46
62 0.45
63 0.43
64 0.39
65 0.43
66 0.43
67 0.4
68 0.42
69 0.45
70 0.44
71 0.44
72 0.42
73 0.33
74 0.28
75 0.26
76 0.21
77 0.18
78 0.15
79 0.16
80 0.15
81 0.14
82 0.13
83 0.1
84 0.09
85 0.08
86 0.08
87 0.09
88 0.09
89 0.09
90 0.1
91 0.13
92 0.14
93 0.19
94 0.2
95 0.21
96 0.24
97 0.26
98 0.24
99 0.23
100 0.23
101 0.18
102 0.17
103 0.15
104 0.13
105 0.12
106 0.13
107 0.11
108 0.11
109 0.19
110 0.21
111 0.27
112 0.35
113 0.44
114 0.51
115 0.62
116 0.71
117 0.73
118 0.79
119 0.82
120 0.76
121 0.69
122 0.63
123 0.53
124 0.44
125 0.35
126 0.26
127 0.18
128 0.13
129 0.09
130 0.06
131 0.06
132 0.05
133 0.05
134 0.04
135 0.05
136 0.05
137 0.06
138 0.08
139 0.11
140 0.11
141 0.11
142 0.13
143 0.15
144 0.15
145 0.17
146 0.16
147 0.21
148 0.31
149 0.31
150 0.34
151 0.34
152 0.34
153 0.36
154 0.37
155 0.33
156 0.26
157 0.3
158 0.28
159 0.32
160 0.31
161 0.27
162 0.27
163 0.26
164 0.23
165 0.19
166 0.17
167 0.12
168 0.14
169 0.19
170 0.17
171 0.22
172 0.26
173 0.32
174 0.37
175 0.39
176 0.45
177 0.5
178 0.59
179 0.64
180 0.7
181 0.73
182 0.77
183 0.83
184 0.85
185 0.86
186 0.83
187 0.77
188 0.73
189 0.71
190 0.61
191 0.58
192 0.49
193 0.41
194 0.37
195 0.33
196 0.3
197 0.22
198 0.23
199 0.22
200 0.21
201 0.22
202 0.24
203 0.26
204 0.28
205 0.31
206 0.32
207 0.3
208 0.32
209 0.3
210 0.27
211 0.26
212 0.21
213 0.22
214 0.2
215 0.19
216 0.22
217 0.2
218 0.22
219 0.25
220 0.27
221 0.3
222 0.37
223 0.47
224 0.51
225 0.61
226 0.7
227 0.74
228 0.78
229 0.8
230 0.76
231 0.71
232 0.69
233 0.59
234 0.5
235 0.45