Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059ELE2

Protein Details
Accession A0A059ELE2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-30KKNEEFKKEKKYLVKIKRTKRIKSSLPBasic
NLS Segment(s)
PositionSequence
9-26FKKEKKYLVKIKRTKRIK
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004015  SKI-int_prot_SKIP_SNW-dom  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF02731  SKIP_SNW  
Amino Acid Sequences MGNKKNEEFKKEKKYLVKIKRTKRIKSSLPSVITQWKNKRGYLISLEKRLSALQDEDLEVNIEAFKKFNEELEKLDEKYRDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.79
4 0.8
5 0.79
6 0.83
7 0.86
8 0.86
9 0.84
10 0.82
11 0.8
12 0.78
13 0.75
14 0.73
15 0.7
16 0.64
17 0.57
18 0.5
19 0.5
20 0.46
21 0.46
22 0.45
23 0.45
24 0.45
25 0.44
26 0.46
27 0.38
28 0.37
29 0.36
30 0.4
31 0.36
32 0.38
33 0.38
34 0.35
35 0.34
36 0.31
37 0.25
38 0.18
39 0.15
40 0.11
41 0.12
42 0.13
43 0.12
44 0.12
45 0.12
46 0.1
47 0.09
48 0.08
49 0.08
50 0.07
51 0.08
52 0.08
53 0.11
54 0.11
55 0.16
56 0.22
57 0.23
58 0.26
59 0.33
60 0.37
61 0.35
62 0.4