Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EJW1

Protein Details
Accession A0A059EJW1   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
84-114SVTNKLIKSNHKKNEIRKRKKDLTIKLTLDRHydrophilic
NLS Segment(s)
PositionSequence
94-104HKKNEIRKRKK
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR026768  FAM72  
Gene Ontology GO:0005737  C:cytoplasm  
Pfam View protein in Pfam  
PF14976  FAM72  
Amino Acid Sequences KIVKGCSESVLLNNELIRMFSTNKIPKNISGVYKAYKSSRCDCIIKDNACNSCGNIVGYSVIQPCIDCLACKNNGNLTMFFYDSVTNKLIKSNHKKNEIRKRKKDLTIKLTLDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.16
4 0.14
5 0.12
6 0.13
7 0.15
8 0.24
9 0.3
10 0.34
11 0.38
12 0.39
13 0.38
14 0.42
15 0.43
16 0.37
17 0.35
18 0.34
19 0.32
20 0.33
21 0.34
22 0.32
23 0.34
24 0.35
25 0.35
26 0.38
27 0.39
28 0.39
29 0.38
30 0.42
31 0.45
32 0.42
33 0.41
34 0.4
35 0.37
36 0.36
37 0.35
38 0.26
39 0.19
40 0.18
41 0.14
42 0.09
43 0.08
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.06
50 0.06
51 0.06
52 0.08
53 0.08
54 0.07
55 0.08
56 0.12
57 0.16
58 0.17
59 0.19
60 0.19
61 0.23
62 0.25
63 0.24
64 0.22
65 0.21
66 0.19
67 0.19
68 0.16
69 0.15
70 0.14
71 0.16
72 0.15
73 0.14
74 0.14
75 0.18
76 0.22
77 0.31
78 0.41
79 0.48
80 0.55
81 0.64
82 0.71
83 0.77
84 0.84
85 0.85
86 0.86
87 0.86
88 0.88
89 0.88
90 0.9
91 0.9
92 0.89
93 0.86
94 0.85