Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EHL5

Protein Details
Accession A0A059EHL5    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
112-135LYYFIIKKRKMIREKKERISEQIFHydrophilic
NLS Segment(s)
PositionSequence
119-127KRKMIREKK
Subcellular Location(s) nucl 19, mito 3, golg 2, plas 1, pero 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences IISSTQNITSTSSHATSPTKIPNTTTNYSSKNDENEIISKTQNIFRNMTQNITSTSSDATSSTKIPNITTILDDNNIFTTVETNNIDGDLDLVKLLCLIGLFAAILSAIFILYYFIIKKRKMIREKKERISEQIFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.28
5 0.34
6 0.34
7 0.34
8 0.36
9 0.41
10 0.46
11 0.46
12 0.44
13 0.41
14 0.41
15 0.42
16 0.43
17 0.39
18 0.34
19 0.33
20 0.32
21 0.28
22 0.27
23 0.27
24 0.25
25 0.22
26 0.21
27 0.2
28 0.24
29 0.27
30 0.27
31 0.28
32 0.28
33 0.35
34 0.34
35 0.34
36 0.29
37 0.25
38 0.24
39 0.25
40 0.23
41 0.16
42 0.16
43 0.14
44 0.13
45 0.13
46 0.12
47 0.09
48 0.1
49 0.11
50 0.12
51 0.12
52 0.12
53 0.13
54 0.13
55 0.13
56 0.12
57 0.12
58 0.11
59 0.11
60 0.11
61 0.1
62 0.09
63 0.09
64 0.08
65 0.07
66 0.08
67 0.07
68 0.1
69 0.1
70 0.1
71 0.09
72 0.09
73 0.09
74 0.07
75 0.08
76 0.06
77 0.05
78 0.05
79 0.05
80 0.04
81 0.04
82 0.04
83 0.04
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.02
96 0.02
97 0.02
98 0.03
99 0.04
100 0.05
101 0.07
102 0.12
103 0.19
104 0.2
105 0.28
106 0.37
107 0.47
108 0.56
109 0.66
110 0.72
111 0.77
112 0.87
113 0.89
114 0.9
115 0.85
116 0.82