Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ETZ2

Protein Details
Accession A0A059ETZ2    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
173-195IYNYSRTKKKFEMKKFKISNSFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 9, cyto 5, pero 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR000795  T_Tr_GTP-bd_dom  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF00009  GTP_EFTU  
CDD cd00882  Ras_like_GTPase  
Amino Acid Sequences MNKENKTYLVLGAFQSGKSELIKLFGSDAEEFNKFPITKYEFMYNITVHSRPFSYLFGDGNIITFIDTPGHCDYIDEALALLKILNDVILVLTLEENVESLYFDILPSLRNKNIYLFLNKMDVSIGNLQRDIIYKIIENIKIDYKKVFLCSAREKWIFEFNPNNCKINQLKMIYNYSRTKKKFEMKKFKISNSFLFQVKRFLTNVNLQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.17
5 0.16
6 0.17
7 0.13
8 0.15
9 0.16
10 0.15
11 0.15
12 0.14
13 0.17
14 0.16
15 0.17
16 0.17
17 0.18
18 0.18
19 0.17
20 0.22
21 0.19
22 0.18
23 0.25
24 0.27
25 0.29
26 0.31
27 0.36
28 0.31
29 0.34
30 0.36
31 0.28
32 0.25
33 0.25
34 0.23
35 0.18
36 0.19
37 0.18
38 0.16
39 0.18
40 0.16
41 0.16
42 0.17
43 0.17
44 0.16
45 0.16
46 0.14
47 0.13
48 0.12
49 0.09
50 0.07
51 0.07
52 0.06
53 0.07
54 0.07
55 0.11
56 0.12
57 0.13
58 0.13
59 0.13
60 0.14
61 0.13
62 0.14
63 0.1
64 0.08
65 0.07
66 0.07
67 0.07
68 0.06
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.04
93 0.05
94 0.08
95 0.1
96 0.11
97 0.13
98 0.13
99 0.15
100 0.19
101 0.2
102 0.21
103 0.2
104 0.2
105 0.21
106 0.2
107 0.18
108 0.15
109 0.12
110 0.12
111 0.17
112 0.17
113 0.16
114 0.16
115 0.16
116 0.16
117 0.17
118 0.16
119 0.11
120 0.1
121 0.09
122 0.12
123 0.16
124 0.17
125 0.17
126 0.17
127 0.23
128 0.24
129 0.25
130 0.23
131 0.21
132 0.21
133 0.23
134 0.25
135 0.2
136 0.25
137 0.32
138 0.36
139 0.42
140 0.42
141 0.41
142 0.4
143 0.46
144 0.41
145 0.39
146 0.43
147 0.39
148 0.47
149 0.48
150 0.47
151 0.38
152 0.43
153 0.4
154 0.37
155 0.41
156 0.35
157 0.37
158 0.4
159 0.47
160 0.44
161 0.49
162 0.51
163 0.51
164 0.57
165 0.56
166 0.58
167 0.6
168 0.67
169 0.7
170 0.73
171 0.77
172 0.75
173 0.84
174 0.84
175 0.83
176 0.83
177 0.78
178 0.74
179 0.69
180 0.65
181 0.59
182 0.56
183 0.49
184 0.47
185 0.44
186 0.4
187 0.34
188 0.32
189 0.33