Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EQ21

Protein Details
Accession A0A059EQ21    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-29SLNYNVTKMKRKRYNPLKNPTARLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR031507  PTP2  
Pfam View protein in Pfam  
PF17022  PTP2  
Amino Acid Sequences GVAESLNYNVTKMKRKRYNPLKNPTARLEFNELGSLLKQEGEIPKPKRLDPCGSCLEKLSKKAQVEGEKDMCGGCDALMELNSLKRGSFNNLQTENKKPEVTPTETTKAAEESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.61
3 0.71
4 0.78
5 0.85
6 0.84
7 0.88
8 0.87
9 0.84
10 0.83
11 0.78
12 0.73
13 0.63
14 0.56
15 0.54
16 0.44
17 0.38
18 0.33
19 0.27
20 0.21
21 0.2
22 0.17
23 0.09
24 0.08
25 0.08
26 0.09
27 0.11
28 0.15
29 0.23
30 0.25
31 0.31
32 0.33
33 0.35
34 0.39
35 0.4
36 0.45
37 0.39
38 0.41
39 0.42
40 0.42
41 0.39
42 0.35
43 0.37
44 0.3
45 0.32
46 0.3
47 0.28
48 0.27
49 0.3
50 0.34
51 0.35
52 0.36
53 0.38
54 0.36
55 0.31
56 0.31
57 0.27
58 0.22
59 0.15
60 0.12
61 0.06
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.07
69 0.09
70 0.09
71 0.09
72 0.1
73 0.12
74 0.18
75 0.25
76 0.28
77 0.35
78 0.4
79 0.46
80 0.48
81 0.54
82 0.53
83 0.49
84 0.46
85 0.38
86 0.42
87 0.43
88 0.46
89 0.44
90 0.45
91 0.46
92 0.46
93 0.47
94 0.4