Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059ELB7

Protein Details
Accession A0A059ELB7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-43KESISTKPPCPPKLKKKKPCKNCSCGRGSNHydrophilic
NLS Segment(s)
PositionSequence
28-30KKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.333, mito_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007785  Anamorsin  
IPR046408  CIAPIN1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF05093  CIAPIN1  
Amino Acid Sequences MEEEDKMNLQEKLKESISTKPPCPPKLKKKKPCKNCSCGRGSNDSSVPYQSKCGGCYLGDDYRCEACPYRGLPAFKPGEEVNFNMDNETL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.37
4 0.44
5 0.44
6 0.43
7 0.45
8 0.52
9 0.55
10 0.62
11 0.64
12 0.66
13 0.72
14 0.81
15 0.84
16 0.87
17 0.91
18 0.93
19 0.94
20 0.92
21 0.9
22 0.88
23 0.85
24 0.81
25 0.76
26 0.69
27 0.65
28 0.57
29 0.51
30 0.43
31 0.37
32 0.3
33 0.26
34 0.24
35 0.17
36 0.16
37 0.17
38 0.16
39 0.15
40 0.16
41 0.15
42 0.14
43 0.16
44 0.19
45 0.2
46 0.2
47 0.2
48 0.21
49 0.22
50 0.23
51 0.22
52 0.2
53 0.17
54 0.2
55 0.21
56 0.25
57 0.29
58 0.31
59 0.3
60 0.38
61 0.39
62 0.35
63 0.37
64 0.31
65 0.31
66 0.31
67 0.31
68 0.27
69 0.28
70 0.28