Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EKI4

Protein Details
Accession A0A059EKI4    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-23VQINESKCGRRKYNRSHNVDGVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 9, nucl 4
Family & Domain DBs
Amino Acid Sequences MVQINESKCGRRKYNRSHNVDGVWFFGGVEVISETKLYCVPVLKRDSLTLTDLVKKSCLNSNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.84
4 0.83
5 0.78
6 0.7
7 0.62
8 0.52
9 0.42
10 0.32
11 0.24
12 0.16
13 0.12
14 0.09
15 0.06
16 0.06
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.05
23 0.06
24 0.06
25 0.06
26 0.1
27 0.12
28 0.19
29 0.23
30 0.25
31 0.25
32 0.26
33 0.29
34 0.27
35 0.28
36 0.24
37 0.22
38 0.28
39 0.28
40 0.28
41 0.27
42 0.26
43 0.26