Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EI11

Protein Details
Accession A0A059EI11    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-46VKDLRSRYPNKIRQGMKKVLCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12.333, cyto 6, cyto_mito 3.999, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR026739  AP_beta  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
IPR002553  Clathrin/coatomer_adapt-like_N  
Gene Ontology GO:0030117  C:membrane coat  
GO:0006886  P:intracellular protein transport  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF01602  Adaptin_N  
Amino Acid Sequences TLKDIKDFLTNSNSYIEGEISMNSVVKDLRSRYPNKIRQGMKKVLCLLQKKHDTAEFKNEILKLLDTRDVPTKRMINYYLLHFYKENKDVCERERLCEMYTNTLLKDLNDINEEIKNSAIEFLIFLKNIEFFPSFARKLKKILENGTIENQILILILIKEYSIINTNFIEKNELSGNIFSLFKENVLQLQIYALECLNTTPPLLIQLQKEEIINFYSKISNLKKFELFYQGLTNIKQAIILNRKIFDTKDVSKILYISIELIKHDYISALIVSDIILSFNISLAQEILNNLENYLFLKNEDLFHLLRYLYKLITKYKLEFNVRKYIIYENDTFYNKKMKFMILNLSVNEFTINEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.21
4 0.14
5 0.14
6 0.13
7 0.12
8 0.12
9 0.12
10 0.11
11 0.12
12 0.11
13 0.12
14 0.18
15 0.2
16 0.27
17 0.35
18 0.4
19 0.49
20 0.6
21 0.66
22 0.7
23 0.75
24 0.75
25 0.77
26 0.81
27 0.81
28 0.75
29 0.73
30 0.68
31 0.65
32 0.64
33 0.62
34 0.58
35 0.58
36 0.61
37 0.57
38 0.56
39 0.56
40 0.54
41 0.51
42 0.56
43 0.49
44 0.42
45 0.45
46 0.41
47 0.37
48 0.33
49 0.3
50 0.21
51 0.2
52 0.24
53 0.2
54 0.22
55 0.29
56 0.29
57 0.29
58 0.34
59 0.36
60 0.34
61 0.38
62 0.38
63 0.34
64 0.34
65 0.37
66 0.39
67 0.35
68 0.35
69 0.31
70 0.33
71 0.35
72 0.39
73 0.37
74 0.32
75 0.37
76 0.39
77 0.4
78 0.47
79 0.41
80 0.38
81 0.4
82 0.38
83 0.33
84 0.37
85 0.35
86 0.31
87 0.33
88 0.31
89 0.26
90 0.27
91 0.26
92 0.19
93 0.22
94 0.17
95 0.15
96 0.15
97 0.16
98 0.15
99 0.17
100 0.17
101 0.13
102 0.13
103 0.11
104 0.1
105 0.1
106 0.08
107 0.06
108 0.06
109 0.08
110 0.1
111 0.1
112 0.1
113 0.09
114 0.1
115 0.1
116 0.13
117 0.11
118 0.1
119 0.14
120 0.19
121 0.2
122 0.25
123 0.29
124 0.27
125 0.31
126 0.37
127 0.39
128 0.39
129 0.42
130 0.44
131 0.43
132 0.43
133 0.42
134 0.36
135 0.3
136 0.24
137 0.19
138 0.12
139 0.09
140 0.07
141 0.04
142 0.03
143 0.03
144 0.04
145 0.03
146 0.04
147 0.04
148 0.05
149 0.08
150 0.08
151 0.1
152 0.1
153 0.13
154 0.14
155 0.14
156 0.17
157 0.13
158 0.15
159 0.14
160 0.14
161 0.12
162 0.11
163 0.11
164 0.09
165 0.1
166 0.08
167 0.09
168 0.08
169 0.08
170 0.09
171 0.08
172 0.08
173 0.09
174 0.09
175 0.06
176 0.07
177 0.07
178 0.06
179 0.07
180 0.06
181 0.05
182 0.05
183 0.06
184 0.06
185 0.06
186 0.06
187 0.05
188 0.05
189 0.07
190 0.09
191 0.11
192 0.11
193 0.13
194 0.15
195 0.15
196 0.16
197 0.14
198 0.13
199 0.12
200 0.12
201 0.11
202 0.1
203 0.11
204 0.11
205 0.18
206 0.21
207 0.26
208 0.28
209 0.31
210 0.32
211 0.32
212 0.34
213 0.34
214 0.31
215 0.25
216 0.25
217 0.24
218 0.23
219 0.23
220 0.21
221 0.15
222 0.14
223 0.14
224 0.12
225 0.18
226 0.22
227 0.27
228 0.28
229 0.28
230 0.29
231 0.29
232 0.29
233 0.26
234 0.26
235 0.25
236 0.29
237 0.29
238 0.29
239 0.28
240 0.28
241 0.25
242 0.18
243 0.15
244 0.11
245 0.12
246 0.11
247 0.11
248 0.13
249 0.12
250 0.12
251 0.12
252 0.1
253 0.08
254 0.08
255 0.07
256 0.06
257 0.05
258 0.05
259 0.05
260 0.05
261 0.05
262 0.04
263 0.04
264 0.05
265 0.05
266 0.05
267 0.06
268 0.06
269 0.06
270 0.06
271 0.07
272 0.07
273 0.08
274 0.1
275 0.12
276 0.12
277 0.12
278 0.12
279 0.11
280 0.12
281 0.13
282 0.11
283 0.09
284 0.11
285 0.13
286 0.14
287 0.16
288 0.18
289 0.16
290 0.17
291 0.19
292 0.16
293 0.17
294 0.18
295 0.18
296 0.17
297 0.21
298 0.23
299 0.28
300 0.34
301 0.37
302 0.38
303 0.44
304 0.51
305 0.56
306 0.59
307 0.59
308 0.62
309 0.59
310 0.56
311 0.5
312 0.48
313 0.45
314 0.43
315 0.41
316 0.34
317 0.38
318 0.4
319 0.4
320 0.36
321 0.4
322 0.35
323 0.37
324 0.36
325 0.37
326 0.38
327 0.41
328 0.48
329 0.46
330 0.49
331 0.45
332 0.47
333 0.41
334 0.36
335 0.33