Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EV07

Protein Details
Accession A0A059EV07    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-95QPKIEENKKTEKKSKAPEKKNVQGNLSHydrophilic
NLS Segment(s)
PositionSequence
76-87KKTEKKSKAPEK
Subcellular Location(s) nucl 11.5cyto_nucl 11.5, cyto 10.5, mito 3
Family & Domain DBs
Amino Acid Sequences MHKFYTFINKEVNLENELIKDTSLKPIYLNSKKKNDVTELYLSTIKDNGILCGVTNGKLDSLIDIFKEQPKIEENKKTEKKSKAPEKKNVQGNLSSFFIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.2
4 0.2
5 0.18
6 0.14
7 0.14
8 0.13
9 0.2
10 0.2
11 0.19
12 0.18
13 0.23
14 0.33
15 0.4
16 0.49
17 0.48
18 0.55
19 0.6
20 0.62
21 0.6
22 0.55
23 0.49
24 0.44
25 0.41
26 0.34
27 0.32
28 0.31
29 0.27
30 0.23
31 0.2
32 0.15
33 0.13
34 0.12
35 0.09
36 0.08
37 0.08
38 0.07
39 0.08
40 0.09
41 0.07
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.06
48 0.07
49 0.06
50 0.06
51 0.07
52 0.09
53 0.12
54 0.15
55 0.14
56 0.15
57 0.19
58 0.25
59 0.31
60 0.39
61 0.4
62 0.49
63 0.57
64 0.63
65 0.67
66 0.7
67 0.72
68 0.74
69 0.81
70 0.81
71 0.82
72 0.85
73 0.86
74 0.86
75 0.86
76 0.81
77 0.74
78 0.69
79 0.62
80 0.56
81 0.48