Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059ET34

Protein Details
Accession A0A059ET34    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
40-93LEMSKKDKEKEQKEKQEKERIEKERKERERREREKRDREEKARKLKQEKLNEIYBasic
NLS Segment(s)
PositionSequence
43-87SKKDKEKEQKEKQEKERIEKERKERERREREKRDREEKARKLKQE
Subcellular Location(s) nucl 20, mito 7
Family & Domain DBs
Amino Acid Sequences MLFVLIFYFFQLSSQSGSNSHNSLHWKNVNTLSKKEKMLLEMSKKDKEKEQKEKQEKERIEKERKERERREREKRDREEKARKLKQEKLNEIYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.17
5 0.19
6 0.19
7 0.18
8 0.2
9 0.25
10 0.26
11 0.31
12 0.33
13 0.32
14 0.35
15 0.43
16 0.47
17 0.44
18 0.48
19 0.47
20 0.47
21 0.46
22 0.45
23 0.37
24 0.32
25 0.34
26 0.35
27 0.35
28 0.37
29 0.41
30 0.44
31 0.44
32 0.42
33 0.43
34 0.46
35 0.49
36 0.53
37 0.59
38 0.64
39 0.73
40 0.8
41 0.82
42 0.82
43 0.76
44 0.74
45 0.73
46 0.72
47 0.72
48 0.7
49 0.72
50 0.73
51 0.79
52 0.82
53 0.82
54 0.84
55 0.86
56 0.89
57 0.9
58 0.91
59 0.92
60 0.92
61 0.92
62 0.91
63 0.9
64 0.91
65 0.91
66 0.89
67 0.89
68 0.87
69 0.87
70 0.85
71 0.84
72 0.83
73 0.83
74 0.83