Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ESB1

Protein Details
Accession A0A059ESB1   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-76IQFNKKNRTENVKKKKELKKIEKETKVVTHydrophilic
NLS Segment(s)
PositionSequence
22-70VKLAKKEVRAANKKRILARKLHGMKAIQFNKKNRTENVKKKKELKKIEK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MAQNNFVEDTIKKNGRALNHEVKLAKKEVRAANKKRILARKLHGMKAIQFNKKNRTENVKKKKELKKIEKETKVVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.4
4 0.43
5 0.44
6 0.43
7 0.46
8 0.44
9 0.44
10 0.42
11 0.4
12 0.35
13 0.26
14 0.31
15 0.33
16 0.42
17 0.5
18 0.52
19 0.59
20 0.61
21 0.64
22 0.63
23 0.65
24 0.58
25 0.54
26 0.5
27 0.51
28 0.5
29 0.48
30 0.45
31 0.38
32 0.39
33 0.43
34 0.48
35 0.45
36 0.47
37 0.5
38 0.56
39 0.63
40 0.64
41 0.59
42 0.63
43 0.66
44 0.71
45 0.76
46 0.77
47 0.77
48 0.83
49 0.87
50 0.87
51 0.87
52 0.87
53 0.87
54 0.88
55 0.91
56 0.89