Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EKN6

Protein Details
Accession A0A059EKN6   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-28LISLHHKIIKEIKKRKKQCSEILFNILHydrophilic
NLS Segment(s)
PositionSequence
14-17KKRK
Subcellular Location(s) mito 14, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences TLISLHHKIIKEIKKRKKQCSEILFNILKHSKINTLIFVYLTLSSEYSPLILKLLNKLNDRINYIEKHTLLVIKEFYENKPTFCFDYPQLHIVLREIMNKCIDKDVDGLIGKYIRNNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.81
3 0.88
4 0.89
5 0.89
6 0.88
7 0.88
8 0.86
9 0.8
10 0.79
11 0.72
12 0.61
13 0.59
14 0.5
15 0.41
16 0.32
17 0.28
18 0.23
19 0.25
20 0.26
21 0.22
22 0.21
23 0.21
24 0.2
25 0.19
26 0.16
27 0.12
28 0.11
29 0.09
30 0.08
31 0.07
32 0.08
33 0.07
34 0.06
35 0.06
36 0.05
37 0.06
38 0.06
39 0.07
40 0.11
41 0.16
42 0.21
43 0.22
44 0.24
45 0.27
46 0.28
47 0.3
48 0.28
49 0.26
50 0.22
51 0.24
52 0.26
53 0.22
54 0.21
55 0.19
56 0.19
57 0.16
58 0.16
59 0.14
60 0.11
61 0.15
62 0.16
63 0.16
64 0.22
65 0.23
66 0.22
67 0.24
68 0.25
69 0.25
70 0.25
71 0.27
72 0.23
73 0.29
74 0.3
75 0.3
76 0.29
77 0.26
78 0.25
79 0.23
80 0.24
81 0.18
82 0.23
83 0.22
84 0.24
85 0.28
86 0.29
87 0.29
88 0.29
89 0.28
90 0.23
91 0.23
92 0.22
93 0.23
94 0.23
95 0.22
96 0.2
97 0.22
98 0.21