Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EGD5

Protein Details
Accession A0A059EGD5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
83-108LGPVTIKKIGKKRKWVKVSRVNSWVHHydrophilic
NLS Segment(s)
PositionSequence
89-99KKIGKKRKWVK
Subcellular Location(s) nucl 13, mito 9, cyto_nucl 9, cyto 3
Family & Domain DBs
Amino Acid Sequences EILRIEKGRSLNKIIHKINNRLSSTYNRSIKTIPEDVINGEKLIIKDKLLEKSEVEKNNDMLKIGDKVFVKNFKADKLDYQYLGPVTIKKIGKKRKWVKVSRVNSWVHVKNIKFWKRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.62
4 0.65
5 0.69
6 0.71
7 0.65
8 0.57
9 0.56
10 0.54
11 0.55
12 0.56
13 0.53
14 0.45
15 0.45
16 0.44
17 0.44
18 0.42
19 0.37
20 0.29
21 0.25
22 0.24
23 0.23
24 0.25
25 0.22
26 0.16
27 0.13
28 0.14
29 0.12
30 0.15
31 0.14
32 0.11
33 0.15
34 0.18
35 0.24
36 0.23
37 0.24
38 0.22
39 0.27
40 0.34
41 0.34
42 0.34
43 0.29
44 0.29
45 0.31
46 0.3
47 0.25
48 0.19
49 0.16
50 0.15
51 0.14
52 0.16
53 0.13
54 0.15
55 0.18
56 0.23
57 0.23
58 0.25
59 0.26
60 0.25
61 0.28
62 0.27
63 0.29
64 0.32
65 0.33
66 0.29
67 0.28
68 0.27
69 0.24
70 0.25
71 0.2
72 0.14
73 0.13
74 0.2
75 0.22
76 0.26
77 0.36
78 0.45
79 0.52
80 0.62
81 0.7
82 0.74
83 0.82
84 0.85
85 0.86
86 0.87
87 0.86
88 0.83
89 0.81
90 0.73
91 0.68
92 0.67
93 0.61
94 0.57
95 0.56
96 0.49
97 0.5
98 0.59