Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059ETT8

Protein Details
Accession A0A059ETT8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
38-60VYAVIKKYKQNLKTKRQFKGGRYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036388  WH-like_DNA-bd_sf  
Pfam View protein in Pfam  
PF13518  HTH_28  
Amino Acid Sequences MPNQQISNENRERIIALYLNEHSASEISKMLGFERTSVYAVIKKYKQNLKTKRQFKGGRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.2
3 0.15
4 0.17
5 0.17
6 0.18
7 0.17
8 0.16
9 0.13
10 0.11
11 0.11
12 0.08
13 0.08
14 0.07
15 0.08
16 0.08
17 0.08
18 0.11
19 0.1
20 0.1
21 0.11
22 0.12
23 0.12
24 0.13
25 0.14
26 0.14
27 0.16
28 0.22
29 0.25
30 0.28
31 0.35
32 0.43
33 0.51
34 0.58
35 0.66
36 0.71
37 0.77
38 0.82
39 0.82
40 0.84