Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EM18

Protein Details
Accession A0A059EM18    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
26-45SKTKIYRKTLYKKNVHGKNAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 11.5, nucl 7.5, mito 4
Family & Domain DBs
Amino Acid Sequences MLNEELSNIFNEILNKVVNNCFVCNSKTKIYRKTLYKKNVHGKNAVKISLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.12
4 0.13
5 0.16
6 0.16
7 0.16
8 0.17
9 0.18
10 0.19
11 0.21
12 0.23
13 0.25
14 0.32
15 0.37
16 0.43
17 0.48
18 0.54
19 0.6
20 0.66
21 0.7
22 0.72
23 0.75
24 0.77
25 0.8
26 0.81
27 0.76
28 0.75
29 0.71
30 0.71
31 0.68