Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EQ47

Protein Details
Accession A0A059EQ47    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
45-70VESFRKILKLKKSKERDLKQTRDIFFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.5, cyto 9, nucl 8, mito 6, golg 3
Family & Domain DBs
Amino Acid Sequences MLGSTIWTGEHKSYSSLMEKGLMHDTTCHKYNLLNKENDVHTQFVESFRKILKLKKSKERDLKQTRDIFFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.2
4 0.19
5 0.2
6 0.2
7 0.2
8 0.23
9 0.2
10 0.16
11 0.19
12 0.22
13 0.23
14 0.24
15 0.22
16 0.19
17 0.21
18 0.28
19 0.34
20 0.36
21 0.33
22 0.32
23 0.35
24 0.36
25 0.36
26 0.31
27 0.22
28 0.16
29 0.16
30 0.16
31 0.17
32 0.19
33 0.17
34 0.17
35 0.17
36 0.23
37 0.24
38 0.3
39 0.36
40 0.43
41 0.51
42 0.6
43 0.68
44 0.73
45 0.82
46 0.84
47 0.84
48 0.85
49 0.85
50 0.84
51 0.83