Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EG42

Protein Details
Accession A0A059EG42    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-31SVTKYDKLDKKEKKLLKNKCRKIYNNKGFFEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 7, nucl 5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008936  Rho_GTPase_activation_prot  
IPR000198  RhoGAP_dom  
Gene Ontology GO:0005096  F:GTPase activator activity  
GO:0007165  P:signal transduction  
PROSITE View protein in PROSITE  
PS50238  RHOGAP  
Amino Acid Sequences SVTKYDKLDKKEKKLLKNKCRKIYNNKGFFESIIDFLNPLNDCMSCEYKPIISSFIYKVIDYLIKEGINTIGIFRLASNNNLTNEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.85
4 0.87
5 0.88
6 0.87
7 0.89
8 0.87
9 0.88
10 0.88
11 0.87
12 0.85
13 0.77
14 0.71
15 0.61
16 0.53
17 0.45
18 0.35
19 0.25
20 0.17
21 0.15
22 0.12
23 0.11
24 0.14
25 0.1
26 0.1
27 0.09
28 0.08
29 0.09
30 0.11
31 0.15
32 0.12
33 0.13
34 0.13
35 0.13
36 0.14
37 0.14
38 0.13
39 0.11
40 0.13
41 0.13
42 0.18
43 0.18
44 0.17
45 0.16
46 0.16
47 0.18
48 0.16
49 0.17
50 0.14
51 0.13
52 0.13
53 0.14
54 0.13
55 0.12
56 0.11
57 0.1
58 0.09
59 0.09
60 0.09
61 0.09
62 0.15
63 0.15
64 0.18
65 0.22
66 0.26