Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EFB0

Protein Details
Accession A0A059EFB0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-38KSSNIPLCNKCNKKKNTKIHCMDFKDYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR031502  Zf_ribonucleo  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF17026  zf-RRPl_C4  
Amino Acid Sequences SSDKTPYILNLKSSNIPLCNKCNKKKNTKIHCMDFKDYLKKLPFCKLCLEEKKLDFKYNFFKHTLFYRRVKSLIKFYYFFIPIYFKNKIINFLFLLWLVRYIAYWRIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.38
4 0.38
5 0.42
6 0.49
7 0.55
8 0.61
9 0.67
10 0.71
11 0.77
12 0.83
13 0.86
14 0.86
15 0.87
16 0.86
17 0.86
18 0.86
19 0.81
20 0.74
21 0.7
22 0.64
23 0.6
24 0.53
25 0.49
26 0.46
27 0.43
28 0.42
29 0.44
30 0.42
31 0.37
32 0.41
33 0.39
34 0.42
35 0.45
36 0.47
37 0.43
38 0.42
39 0.48
40 0.45
41 0.45
42 0.37
43 0.33
44 0.39
45 0.37
46 0.38
47 0.32
48 0.31
49 0.28
50 0.35
51 0.39
52 0.35
53 0.37
54 0.38
55 0.39
56 0.42
57 0.45
58 0.41
59 0.44
60 0.44
61 0.43
62 0.39
63 0.38
64 0.41
65 0.38
66 0.34
67 0.27
68 0.24
69 0.22
70 0.27
71 0.28
72 0.23
73 0.28
74 0.29
75 0.34
76 0.33
77 0.34
78 0.29
79 0.28
80 0.28
81 0.22
82 0.23
83 0.16
84 0.16
85 0.13
86 0.11
87 0.11
88 0.12