Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ENI4

Protein Details
Accession A0A059ENI4   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-26LLFSWFKRIPKERKIIKMEKKEVEKHydrophilic
NLS Segment(s)
PositionSequence
12-15KERK
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, mito 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PROSITE View protein in PROSITE  
PS50255  CYTOCHROME_B5_2  
Amino Acid Sequences MLLFSWFKRIPKERKIIKMEKKEVEKHNVLDDCWVIIENNVYDVTEFIEYHPCGRNIFLNYGGKDVTEIFNRVHPYVSYKELLKYEQVGYLENE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.82
3 0.83
4 0.84
5 0.85
6 0.84
7 0.81
8 0.79
9 0.78
10 0.75
11 0.72
12 0.66
13 0.57
14 0.56
15 0.49
16 0.42
17 0.35
18 0.29
19 0.21
20 0.17
21 0.16
22 0.08
23 0.07
24 0.08
25 0.06
26 0.07
27 0.06
28 0.06
29 0.06
30 0.06
31 0.07
32 0.06
33 0.06
34 0.06
35 0.11
36 0.11
37 0.13
38 0.16
39 0.15
40 0.15
41 0.15
42 0.19
43 0.16
44 0.18
45 0.21
46 0.23
47 0.23
48 0.24
49 0.23
50 0.19
51 0.17
52 0.17
53 0.14
54 0.12
55 0.13
56 0.13
57 0.17
58 0.2
59 0.2
60 0.2
61 0.18
62 0.21
63 0.23
64 0.27
65 0.25
66 0.24
67 0.28
68 0.29
69 0.3
70 0.28
71 0.28
72 0.25
73 0.27
74 0.26