Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EUN7

Protein Details
Accession A0A059EUN7    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
25-52NSKTKIYRKTLYKRKCTWKKCSKNFSLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 7, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MLNEELSNIFNEILNKIGNNCFVCNSKTKIYRKTLYKRKCTWKKCSKNFSLLENTLFNSSKIPLIKKLLIIKLWCTKIKLSAISETTKTSKQSISKVMKRLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.14
4 0.16
5 0.19
6 0.2
7 0.2
8 0.21
9 0.22
10 0.24
11 0.27
12 0.29
13 0.31
14 0.38
15 0.44
16 0.5
17 0.55
18 0.6
19 0.65
20 0.72
21 0.75
22 0.75
23 0.79
24 0.79
25 0.82
26 0.85
27 0.84
28 0.84
29 0.85
30 0.86
31 0.86
32 0.87
33 0.8
34 0.79
35 0.73
36 0.66
37 0.61
38 0.52
39 0.44
40 0.35
41 0.31
42 0.24
43 0.23
44 0.18
45 0.13
46 0.12
47 0.13
48 0.15
49 0.16
50 0.17
51 0.21
52 0.22
53 0.26
54 0.3
55 0.3
56 0.31
57 0.31
58 0.32
59 0.35
60 0.38
61 0.36
62 0.33
63 0.31
64 0.34
65 0.36
66 0.36
67 0.31
68 0.33
69 0.34
70 0.35
71 0.36
72 0.34
73 0.34
74 0.32
75 0.32
76 0.29
77 0.32
78 0.33
79 0.38
80 0.45
81 0.52
82 0.56