Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ESC2

Protein Details
Accession A0A059ESC2   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
51-82IQQFENKKKNKKVEKKAPTPSKRKPIKKEVVSHydrophilic
NLS Segment(s)
PositionSequence
57-78KKKNKKVEKKAPTPSKRKPIKK
Subcellular Location(s) nucl 18, cyto 5, mito 1, pero 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR023780  Chromo_domain  
Pfam View protein in Pfam  
PF00385  Chromo  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
CDD cd00024  CD_CSD  
Amino Acid Sequences MAKKEDVYNVEEILDSRDYMGKKQYYIKWEGYDHEHNTWEYAKDVFCKDLIQQFENKKKNKKVEKKAPTPSKRKPIKKEVVSETEYEIKDINDKIKLVKSVYQKEGLLFFQVEYLDGSTGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.12
4 0.16
5 0.16
6 0.18
7 0.25
8 0.23
9 0.25
10 0.33
11 0.37
12 0.39
13 0.43
14 0.45
15 0.41
16 0.41
17 0.41
18 0.4
19 0.42
20 0.39
21 0.36
22 0.34
23 0.3
24 0.3
25 0.28
26 0.22
27 0.16
28 0.14
29 0.13
30 0.14
31 0.15
32 0.14
33 0.13
34 0.13
35 0.13
36 0.17
37 0.19
38 0.17
39 0.22
40 0.28
41 0.37
42 0.43
43 0.48
44 0.51
45 0.55
46 0.64
47 0.69
48 0.73
49 0.74
50 0.78
51 0.82
52 0.83
53 0.86
54 0.87
55 0.86
56 0.85
57 0.82
58 0.82
59 0.82
60 0.82
61 0.8
62 0.8
63 0.81
64 0.78
65 0.78
66 0.74
67 0.7
68 0.63
69 0.56
70 0.48
71 0.44
72 0.38
73 0.3
74 0.24
75 0.18
76 0.19
77 0.2
78 0.2
79 0.16
80 0.17
81 0.2
82 0.23
83 0.26
84 0.25
85 0.3
86 0.36
87 0.41
88 0.44
89 0.46
90 0.42
91 0.41
92 0.41
93 0.36
94 0.3
95 0.22
96 0.18
97 0.16
98 0.15
99 0.14
100 0.13
101 0.13