Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ENY0

Protein Details
Accession A0A059ENY0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
40-93LEMSKKDKEKEQKEKQEKERIEKERKERERREREKRDREEKARKLKQEKLNEIYBasic
NLS Segment(s)
PositionSequence
43-86SKKDKEKEQKEKQEKERIEKERKERERREREKRDREEKARKLKQ
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MLFVLIFYFLQLSSQSGSNSHDSLHWKNVNTLSKKEKMLLEMSKKDKEKEQKEKQEKERIEKERKERERREREKRDREEKARKLKQEKLNEIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.16
5 0.17
6 0.17
7 0.16
8 0.18
9 0.22
10 0.25
11 0.32
12 0.32
13 0.31
14 0.34
15 0.4
16 0.45
17 0.43
18 0.45
19 0.43
20 0.44
21 0.44
22 0.43
23 0.37
24 0.32
25 0.34
26 0.34
27 0.35
28 0.37
29 0.4
30 0.43
31 0.43
32 0.42
33 0.43
34 0.46
35 0.49
36 0.53
37 0.59
38 0.64
39 0.72
40 0.8
41 0.82
42 0.83
43 0.77
44 0.74
45 0.74
46 0.72
47 0.72
48 0.7
49 0.72
50 0.73
51 0.8
52 0.82
53 0.82
54 0.84
55 0.86
56 0.89
57 0.91
58 0.91
59 0.92
60 0.92
61 0.92
62 0.91
63 0.91
64 0.91
65 0.91
66 0.89
67 0.89
68 0.87
69 0.87
70 0.85
71 0.84
72 0.83
73 0.83