Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EMH9

Protein Details
Accession A0A059EMH9   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-121NQKEKNLISKLKKKYKKFKKYKKNLKNIIYKLNIHydrophilic
NLS Segment(s)
PositionSequence
96-111SKLKKKYKKFKKYKKN
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 7, cyto 6.5
Family & Domain DBs
Amino Acid Sequences FNKKVEFKYWYDPSLDLICQKHKALEGIKIQDKNVKELIPKINKLIEILNKLFLRSKEINSILIDLFDEIKLTRTKDGTLTDNEIVPNQKEKNLISKLKKKYKKFKKYKKNLKNIIYKLNISVIKYLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.29
4 0.27
5 0.29
6 0.3
7 0.31
8 0.29
9 0.27
10 0.31
11 0.29
12 0.33
13 0.35
14 0.39
15 0.44
16 0.44
17 0.43
18 0.43
19 0.41
20 0.38
21 0.34
22 0.28
23 0.24
24 0.28
25 0.37
26 0.38
27 0.39
28 0.37
29 0.36
30 0.35
31 0.34
32 0.32
33 0.27
34 0.25
35 0.24
36 0.27
37 0.25
38 0.25
39 0.27
40 0.24
41 0.27
42 0.24
43 0.25
44 0.25
45 0.26
46 0.27
47 0.24
48 0.26
49 0.18
50 0.16
51 0.14
52 0.09
53 0.08
54 0.06
55 0.06
56 0.04
57 0.07
58 0.08
59 0.1
60 0.11
61 0.11
62 0.12
63 0.15
64 0.18
65 0.18
66 0.19
67 0.23
68 0.22
69 0.22
70 0.22
71 0.2
72 0.19
73 0.17
74 0.2
75 0.17
76 0.19
77 0.2
78 0.21
79 0.28
80 0.34
81 0.42
82 0.46
83 0.54
84 0.62
85 0.7
86 0.78
87 0.8
88 0.83
89 0.86
90 0.88
91 0.9
92 0.91
93 0.92
94 0.95
95 0.96
96 0.96
97 0.96
98 0.94
99 0.92
100 0.92
101 0.86
102 0.85
103 0.79
104 0.69
105 0.6
106 0.57
107 0.5
108 0.41