Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EGP1

Protein Details
Accession A0A059EGP1   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20VSKKKCIKAFKEHWKRLVQNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 8.833, mito 7.5, mito_nucl 6.333, nucl 4
Family & Domain DBs
Amino Acid Sequences VSKKKCIKAFKEHWKRLVQNYYNSIGSLGGSGMIVESMNQSLVKIYNRGHPVKGVWVFGVVEISQSRKILLIPIIKRDSDSILSILKKYVLNDTIIYSDSWKEYSKLKDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.77
4 0.77
5 0.71
6 0.67
7 0.64
8 0.6
9 0.51
10 0.46
11 0.38
12 0.27
13 0.21
14 0.14
15 0.09
16 0.06
17 0.05
18 0.04
19 0.04
20 0.04
21 0.03
22 0.03
23 0.04
24 0.04
25 0.05
26 0.05
27 0.05
28 0.06
29 0.08
30 0.09
31 0.11
32 0.12
33 0.18
34 0.24
35 0.25
36 0.25
37 0.24
38 0.24
39 0.27
40 0.27
41 0.21
42 0.16
43 0.15
44 0.14
45 0.13
46 0.13
47 0.07
48 0.06
49 0.06
50 0.08
51 0.08
52 0.09
53 0.09
54 0.08
55 0.09
56 0.1
57 0.14
58 0.2
59 0.2
60 0.27
61 0.3
62 0.29
63 0.3
64 0.29
65 0.27
66 0.22
67 0.21
68 0.16
69 0.18
70 0.19
71 0.19
72 0.18
73 0.18
74 0.18
75 0.18
76 0.22
77 0.2
78 0.21
79 0.21
80 0.22
81 0.21
82 0.21
83 0.2
84 0.16
85 0.16
86 0.15
87 0.17
88 0.17
89 0.17
90 0.22