Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EVQ8

Protein Details
Accession A0A059EVQ8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
249-272RTPYPFPKLFLRPKVKRNKIEEFEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR045097  Thymidate_synth/dCMP_Mease  
IPR023451  Thymidate_synth/dCMP_Mease_dom  
IPR036926  Thymidate_synth/dCMP_Mease_sf  
IPR000398  Thymidylate_synthase  
IPR020940  Thymidylate_synthase_AS  
Gene Ontology GO:0004799  F:thymidylate synthase activity  
GO:0006231  P:dTMP biosynthetic process  
GO:0006235  P:dTTP biosynthetic process  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF00303  Thymidylat_synt  
PROSITE View protein in PROSITE  
PS00091  THYMIDYLATE_SYNTHASE  
CDD cd00351  TS_Pyrimidine_HMase  
Amino Acid Sequences MSKEENEEVQYLNLIKEILSKGTKKHDRTGVGTISRFGAMMRFSLQNNTFPLLTTKKMAIRSILEELLFFVRGETNNDILKEKNVHIWTGNSTREFFDKQGITRREGDLGPVYGFQWRHYGASYTTCEEDYSNKGIDQLQNVINEIKNNPDSRRLIVVSWNPIQLKEMALPPCHLLFQFNVTNGFLNCALYQRSGDVGLGIPFNIASYAMLTYMIAYLTDLQPGEFVHFIADAHIYTNHVDQLSEQILRTPYPFPKLFLRPKVKRNKIEEFEYEDFVIEDYKSHGILKMQMAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.15
4 0.17
5 0.19
6 0.24
7 0.26
8 0.3
9 0.41
10 0.5
11 0.49
12 0.56
13 0.59
14 0.59
15 0.62
16 0.64
17 0.61
18 0.58
19 0.54
20 0.47
21 0.4
22 0.35
23 0.29
24 0.22
25 0.17
26 0.12
27 0.12
28 0.14
29 0.15
30 0.16
31 0.23
32 0.24
33 0.26
34 0.27
35 0.28
36 0.25
37 0.23
38 0.28
39 0.24
40 0.24
41 0.23
42 0.24
43 0.26
44 0.3
45 0.31
46 0.29
47 0.29
48 0.31
49 0.32
50 0.3
51 0.25
52 0.21
53 0.22
54 0.19
55 0.17
56 0.13
57 0.09
58 0.1
59 0.11
60 0.15
61 0.16
62 0.18
63 0.19
64 0.21
65 0.21
66 0.2
67 0.22
68 0.22
69 0.2
70 0.24
71 0.23
72 0.23
73 0.23
74 0.24
75 0.26
76 0.28
77 0.3
78 0.24
79 0.25
80 0.25
81 0.26
82 0.26
83 0.22
84 0.23
85 0.22
86 0.23
87 0.32
88 0.33
89 0.33
90 0.34
91 0.34
92 0.31
93 0.29
94 0.28
95 0.21
96 0.19
97 0.16
98 0.14
99 0.13
100 0.14
101 0.14
102 0.13
103 0.14
104 0.13
105 0.14
106 0.14
107 0.15
108 0.13
109 0.17
110 0.18
111 0.17
112 0.17
113 0.16
114 0.16
115 0.14
116 0.16
117 0.14
118 0.15
119 0.14
120 0.13
121 0.14
122 0.15
123 0.16
124 0.15
125 0.15
126 0.15
127 0.15
128 0.16
129 0.16
130 0.14
131 0.14
132 0.13
133 0.13
134 0.13
135 0.15
136 0.15
137 0.2
138 0.21
139 0.22
140 0.25
141 0.23
142 0.2
143 0.23
144 0.25
145 0.24
146 0.24
147 0.25
148 0.22
149 0.21
150 0.22
151 0.17
152 0.15
153 0.12
154 0.15
155 0.15
156 0.15
157 0.16
158 0.16
159 0.16
160 0.16
161 0.14
162 0.11
163 0.09
164 0.13
165 0.14
166 0.13
167 0.14
168 0.14
169 0.16
170 0.14
171 0.15
172 0.11
173 0.1
174 0.1
175 0.1
176 0.11
177 0.1
178 0.11
179 0.09
180 0.1
181 0.1
182 0.09
183 0.08
184 0.08
185 0.08
186 0.08
187 0.07
188 0.06
189 0.06
190 0.06
191 0.05
192 0.05
193 0.04
194 0.04
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.04
203 0.04
204 0.06
205 0.06
206 0.08
207 0.08
208 0.08
209 0.08
210 0.09
211 0.11
212 0.09
213 0.09
214 0.08
215 0.08
216 0.08
217 0.08
218 0.09
219 0.07
220 0.08
221 0.09
222 0.09
223 0.1
224 0.11
225 0.12
226 0.12
227 0.12
228 0.11
229 0.15
230 0.17
231 0.17
232 0.16
233 0.18
234 0.19
235 0.2
236 0.21
237 0.21
238 0.22
239 0.29
240 0.3
241 0.29
242 0.36
243 0.45
244 0.53
245 0.58
246 0.65
247 0.66
248 0.75
249 0.83
250 0.85
251 0.85
252 0.84
253 0.84
254 0.8
255 0.78
256 0.73
257 0.71
258 0.64
259 0.58
260 0.5
261 0.39
262 0.33
263 0.26
264 0.22
265 0.13
266 0.11
267 0.11
268 0.12
269 0.12
270 0.13
271 0.15
272 0.16
273 0.22