Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EKZ4

Protein Details
Accession A0A059EKZ4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
31-54IDLIDKPSKRKVKNKYKIKEHGFTHydrophilic
NLS Segment(s)
PositionSequence
38-46SKRKVKNKY
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
Amino Acid Sequences MDKSFEEILSERLSLIFDKYNDVEDKKCKTIDLIDKPSKRKVKNKYKIKEHGFTEKNLNPFFFCQKTRVIDTTKEISFVNFKYEFDKLYTKAFMKTFDSILTYYENFDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.14
5 0.18
6 0.18
7 0.22
8 0.24
9 0.26
10 0.28
11 0.3
12 0.35
13 0.34
14 0.34
15 0.3
16 0.29
17 0.34
18 0.4
19 0.43
20 0.47
21 0.52
22 0.57
23 0.6
24 0.67
25 0.67
26 0.64
27 0.64
28 0.66
29 0.68
30 0.73
31 0.8
32 0.81
33 0.83
34 0.86
35 0.84
36 0.79
37 0.71
38 0.7
39 0.61
40 0.53
41 0.5
42 0.43
43 0.41
44 0.35
45 0.32
46 0.23
47 0.23
48 0.26
49 0.22
50 0.2
51 0.19
52 0.22
53 0.25
54 0.28
55 0.3
56 0.29
57 0.28
58 0.31
59 0.34
60 0.3
61 0.28
62 0.24
63 0.22
64 0.22
65 0.2
66 0.22
67 0.18
68 0.18
69 0.2
70 0.21
71 0.21
72 0.21
73 0.26
74 0.21
75 0.25
76 0.29
77 0.27
78 0.31
79 0.31
80 0.31
81 0.3
82 0.31
83 0.28
84 0.25
85 0.27
86 0.22
87 0.22
88 0.23
89 0.19