Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EG34

Protein Details
Accession A0A059EG34    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
61-80KETIIKERKVRSRARARDVKBasic
NLS Segment(s)
PositionSequence
67-78ERKVRSRARARD
Subcellular Location(s) cyto_nucl 13.5, cyto 12.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019473  TFIID_su8_C  
Pfam View protein in Pfam  
PF10406  TAF8_C  
Amino Acid Sequences TLIDFITKFELNDVKSYDLVNYEYPQEEKVADFVGPISTPVEKFMYIYEFMPPFPPLHTFKETIIKERKVRSRARARDVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.23
4 0.2
5 0.18
6 0.18
7 0.16
8 0.15
9 0.14
10 0.15
11 0.15
12 0.15
13 0.14
14 0.13
15 0.11
16 0.11
17 0.1
18 0.08
19 0.07
20 0.07
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.08
28 0.08
29 0.08
30 0.08
31 0.08
32 0.1
33 0.1
34 0.11
35 0.12
36 0.12
37 0.12
38 0.13
39 0.14
40 0.12
41 0.12
42 0.16
43 0.17
44 0.23
45 0.26
46 0.27
47 0.28
48 0.37
49 0.37
50 0.41
51 0.46
52 0.47
53 0.5
54 0.57
55 0.64
56 0.62
57 0.69
58 0.72
59 0.74
60 0.77