Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ENR0

Protein Details
Accession A0A059ENR0   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-65SLKKILLKSKQLFKRKLKEKIKFNNEREELHydrophilic
NLS Segment(s)
PositionSequence
43-57KSKQLFKRKLKEKIK
Subcellular Location(s) nucl 12.5, mito_nucl 11.666, cyto_nucl 9.833, mito 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005314  Peptidase_C50  
Gene Ontology GO:0005634  C:nucleus  
GO:0004197  F:cysteine-type endopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF03568  Peptidase_C50  
Amino Acid Sequences DLFTNKNVLSIHKRNSFLELTLYPSQETQRIKINFSLKKILLKSKQLFKRKLKEKIKFNNEREELNKKIEEKVRLFNQSLAFENVKYLLVENFEFPFEHCMKLKNSKRIFNLSGKQLDYKYSSIFYVLDPQNKLPKTREKLLPHLKKYSGVVNRSAEQSDIASQPIYLLYFGHGNGNSYLKFRSKTASVCLFGCSSAKRFFFTGANPHGAVYKYKCNKFIGCLWDVSDRDIDSISIKYITDGVIDCSVAKYMYLGGSAVVTYEII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.56
3 0.51
4 0.43
5 0.4
6 0.32
7 0.32
8 0.32
9 0.32
10 0.27
11 0.27
12 0.28
13 0.28
14 0.3
15 0.25
16 0.31
17 0.32
18 0.35
19 0.39
20 0.46
21 0.46
22 0.47
23 0.53
24 0.46
25 0.51
26 0.53
27 0.55
28 0.53
29 0.58
30 0.6
31 0.62
32 0.7
33 0.72
34 0.77
35 0.78
36 0.81
37 0.81
38 0.85
39 0.85
40 0.85
41 0.86
42 0.87
43 0.89
44 0.89
45 0.83
46 0.83
47 0.74
48 0.69
49 0.64
50 0.6
51 0.52
52 0.46
53 0.45
54 0.36
55 0.41
56 0.42
57 0.44
58 0.41
59 0.45
60 0.46
61 0.48
62 0.47
63 0.45
64 0.43
65 0.37
66 0.36
67 0.32
68 0.27
69 0.22
70 0.21
71 0.18
72 0.15
73 0.13
74 0.11
75 0.08
76 0.09
77 0.1
78 0.1
79 0.1
80 0.1
81 0.1
82 0.1
83 0.15
84 0.14
85 0.15
86 0.15
87 0.17
88 0.2
89 0.31
90 0.37
91 0.42
92 0.46
93 0.51
94 0.54
95 0.57
96 0.58
97 0.55
98 0.53
99 0.49
100 0.47
101 0.41
102 0.4
103 0.33
104 0.31
105 0.26
106 0.23
107 0.18
108 0.15
109 0.14
110 0.13
111 0.13
112 0.11
113 0.16
114 0.17
115 0.2
116 0.2
117 0.21
118 0.27
119 0.27
120 0.29
121 0.25
122 0.32
123 0.34
124 0.4
125 0.47
126 0.45
127 0.54
128 0.63
129 0.67
130 0.62
131 0.62
132 0.56
133 0.5
134 0.47
135 0.45
136 0.4
137 0.33
138 0.34
139 0.31
140 0.32
141 0.31
142 0.3
143 0.22
144 0.17
145 0.15
146 0.13
147 0.11
148 0.1
149 0.09
150 0.08
151 0.08
152 0.08
153 0.07
154 0.05
155 0.05
156 0.05
157 0.06
158 0.07
159 0.1
160 0.1
161 0.11
162 0.12
163 0.14
164 0.14
165 0.14
166 0.16
167 0.16
168 0.17
169 0.17
170 0.19
171 0.2
172 0.22
173 0.28
174 0.32
175 0.31
176 0.3
177 0.31
178 0.27
179 0.25
180 0.24
181 0.2
182 0.17
183 0.21
184 0.22
185 0.21
186 0.22
187 0.24
188 0.24
189 0.26
190 0.3
191 0.28
192 0.31
193 0.3
194 0.29
195 0.29
196 0.28
197 0.28
198 0.24
199 0.3
200 0.35
201 0.39
202 0.43
203 0.45
204 0.46
205 0.46
206 0.49
207 0.45
208 0.39
209 0.37
210 0.35
211 0.38
212 0.36
213 0.34
214 0.29
215 0.23
216 0.21
217 0.2
218 0.18
219 0.13
220 0.14
221 0.13
222 0.12
223 0.11
224 0.11
225 0.11
226 0.11
227 0.11
228 0.11
229 0.13
230 0.13
231 0.13
232 0.13
233 0.13
234 0.14
235 0.12
236 0.11
237 0.08
238 0.09
239 0.09
240 0.1
241 0.09
242 0.08
243 0.09
244 0.09
245 0.08