Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EKJ5

Protein Details
Accession A0A059EKJ5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-94IPQNPKPRMRGRKLKREIGKKANBasic
NLS Segment(s)
PositionSequence
76-92PKPRMRGRKLKREIGKK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences DYSRIGDFLNNLNLPESSRKKNEDTRNKKTNSKNIQEKTSDPSKTKIIITNNIHQPGKTNEKDIRGNIPNNIPQNPKPRMRGRKLKREIGKKANLDVNEDKNLYLNNESNDSYILNAIKNYPIRFNEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.31
3 0.32
4 0.32
5 0.38
6 0.42
7 0.47
8 0.56
9 0.64
10 0.67
11 0.71
12 0.73
13 0.77
14 0.78
15 0.8
16 0.79
17 0.79
18 0.77
19 0.77
20 0.78
21 0.73
22 0.74
23 0.68
24 0.61
25 0.57
26 0.55
27 0.48
28 0.4
29 0.38
30 0.35
31 0.34
32 0.34
33 0.33
34 0.29
35 0.35
36 0.37
37 0.42
38 0.44
39 0.46
40 0.45
41 0.39
42 0.38
43 0.34
44 0.38
45 0.31
46 0.3
47 0.28
48 0.33
49 0.36
50 0.34
51 0.36
52 0.32
53 0.32
54 0.3
55 0.3
56 0.3
57 0.3
58 0.32
59 0.28
60 0.29
61 0.37
62 0.4
63 0.42
64 0.45
65 0.52
66 0.59
67 0.64
68 0.7
69 0.71
70 0.77
71 0.79
72 0.81
73 0.8
74 0.8
75 0.81
76 0.79
77 0.79
78 0.7
79 0.67
80 0.63
81 0.55
82 0.51
83 0.47
84 0.42
85 0.38
86 0.36
87 0.31
88 0.27
89 0.27
90 0.23
91 0.22
92 0.2
93 0.18
94 0.21
95 0.22
96 0.21
97 0.21
98 0.19
99 0.16
100 0.16
101 0.15
102 0.13
103 0.13
104 0.14
105 0.19
106 0.24
107 0.26
108 0.3