Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EFK6

Protein Details
Accession A0A059EFK6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24EKENKETGRLKKNKNKKVILTTEFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences EKENKETGRLKKNKNKKVILTTEFVKPNEEGLAFDNGHFNKLTINNKHSDKLEKMFEEDSLEDQEISESVSSVKNIKKAATAKIIFKNEKLSLLDYNFFGYLTSLQGEEAFFVNLISHDKEIFPYKIIDRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.83
4 0.84
5 0.83
6 0.77
7 0.7
8 0.63
9 0.61
10 0.57
11 0.49
12 0.41
13 0.32
14 0.29
15 0.26
16 0.23
17 0.17
18 0.14
19 0.18
20 0.16
21 0.16
22 0.2
23 0.18
24 0.19
25 0.18
26 0.16
27 0.15
28 0.2
29 0.28
30 0.28
31 0.31
32 0.35
33 0.37
34 0.4
35 0.38
36 0.38
37 0.34
38 0.32
39 0.34
40 0.29
41 0.29
42 0.27
43 0.25
44 0.22
45 0.19
46 0.16
47 0.13
48 0.12
49 0.1
50 0.09
51 0.09
52 0.06
53 0.06
54 0.05
55 0.03
56 0.04
57 0.05
58 0.06
59 0.09
60 0.11
61 0.14
62 0.15
63 0.16
64 0.2
65 0.23
66 0.26
67 0.31
68 0.32
69 0.34
70 0.4
71 0.46
72 0.42
73 0.4
74 0.42
75 0.35
76 0.35
77 0.31
78 0.27
79 0.24
80 0.25
81 0.25
82 0.2
83 0.2
84 0.17
85 0.16
86 0.13
87 0.1
88 0.09
89 0.09
90 0.09
91 0.08
92 0.08
93 0.08
94 0.08
95 0.09
96 0.09
97 0.08
98 0.07
99 0.07
100 0.07
101 0.07
102 0.11
103 0.12
104 0.12
105 0.12
106 0.13
107 0.16
108 0.22
109 0.22
110 0.21
111 0.23