Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2VXT8

Protein Details
Accession B2VXT8    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
202-226LSSLLDRKRKATKQKTGKKNKAVKVHydrophilic
NLS Segment(s)
PositionSequence
72-116KRQRQRPEKPNAPAPTKKTTVTKKPVATKKTGTKKSVTAKKTHGR
208-226RKRKATKQKTGKKNKAVKV
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MAKSNPNRSKPSSPISHNGNESNVEATQPANQPTSKKTSNAISKGYVMVEEHVPTRLIISDPTAPENIIQGKRQRQRPEKPNAPAPTKKTTVTKKPVATKKTGTKKSVTAKKTHGRGATKNYDDGDDDASESGSEPEPESEYEREPRPERQDIAPKAIHRSVLDLVKHSLKVSDNLISYMKAMEDDHEKEGRALDRGVSRVLSSLLDRKRKATKQKTGKKNKAVKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.66
3 0.64
4 0.61
5 0.56
6 0.5
7 0.43
8 0.38
9 0.33
10 0.26
11 0.2
12 0.16
13 0.14
14 0.17
15 0.19
16 0.2
17 0.21
18 0.22
19 0.25
20 0.29
21 0.36
22 0.34
23 0.32
24 0.34
25 0.4
26 0.47
27 0.49
28 0.48
29 0.43
30 0.41
31 0.4
32 0.37
33 0.28
34 0.2
35 0.17
36 0.15
37 0.14
38 0.13
39 0.12
40 0.13
41 0.12
42 0.12
43 0.11
44 0.1
45 0.09
46 0.11
47 0.15
48 0.15
49 0.18
50 0.17
51 0.16
52 0.16
53 0.18
54 0.21
55 0.19
56 0.22
57 0.26
58 0.35
59 0.42
60 0.5
61 0.57
62 0.61
63 0.69
64 0.75
65 0.79
66 0.78
67 0.77
68 0.78
69 0.74
70 0.72
71 0.67
72 0.63
73 0.58
74 0.52
75 0.48
76 0.47
77 0.48
78 0.51
79 0.53
80 0.54
81 0.54
82 0.61
83 0.66
84 0.62
85 0.6
86 0.57
87 0.58
88 0.62
89 0.63
90 0.56
91 0.51
92 0.54
93 0.59
94 0.61
95 0.54
96 0.49
97 0.5
98 0.53
99 0.55
100 0.52
101 0.48
102 0.44
103 0.45
104 0.48
105 0.48
106 0.42
107 0.4
108 0.36
109 0.31
110 0.28
111 0.25
112 0.19
113 0.12
114 0.11
115 0.09
116 0.09
117 0.08
118 0.07
119 0.07
120 0.06
121 0.06
122 0.06
123 0.07
124 0.08
125 0.09
126 0.12
127 0.12
128 0.14
129 0.18
130 0.2
131 0.25
132 0.27
133 0.32
134 0.35
135 0.38
136 0.39
137 0.41
138 0.49
139 0.46
140 0.49
141 0.47
142 0.41
143 0.42
144 0.41
145 0.37
146 0.27
147 0.28
148 0.25
149 0.27
150 0.26
151 0.23
152 0.25
153 0.26
154 0.26
155 0.23
156 0.22
157 0.18
158 0.2
159 0.2
160 0.21
161 0.19
162 0.2
163 0.21
164 0.19
165 0.18
166 0.16
167 0.13
168 0.1
169 0.1
170 0.1
171 0.15
172 0.17
173 0.21
174 0.22
175 0.23
176 0.22
177 0.26
178 0.25
179 0.22
180 0.19
181 0.19
182 0.22
183 0.23
184 0.24
185 0.21
186 0.19
187 0.18
188 0.19
189 0.16
190 0.15
191 0.22
192 0.29
193 0.37
194 0.38
195 0.43
196 0.52
197 0.6
198 0.68
199 0.71
200 0.73
201 0.76
202 0.85
203 0.9
204 0.92
205 0.94
206 0.93