Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EKW4

Protein Details
Accession A0A059EKW4    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
22-47LHDEEKDTNKRNKRKQKYVTLEDKKEBasic
NLS Segment(s)
PositionSequence
13-14KK
32-35RNKR
103-108RRRRKK
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MKKAFLIIKKINKKKEMSKNILHDEEKDTNKRNKRKQKYVTLEDKKEIEKNYLERIGDRINKPIDCENGVLFENDRIFLEDHKDCNYCRIISEYFKEFDILGRRRRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.8
4 0.77
5 0.76
6 0.76
7 0.76
8 0.75
9 0.66
10 0.57
11 0.53
12 0.52
13 0.49
14 0.46
15 0.46
16 0.48
17 0.57
18 0.64
19 0.68
20 0.72
21 0.77
22 0.82
23 0.85
24 0.87
25 0.87
26 0.87
27 0.87
28 0.85
29 0.78
30 0.69
31 0.62
32 0.53
33 0.47
34 0.39
35 0.31
36 0.25
37 0.24
38 0.26
39 0.26
40 0.24
41 0.21
42 0.22
43 0.24
44 0.27
45 0.26
46 0.26
47 0.27
48 0.27
49 0.29
50 0.29
51 0.26
52 0.22
53 0.22
54 0.17
55 0.17
56 0.17
57 0.15
58 0.13
59 0.12
60 0.11
61 0.1
62 0.11
63 0.1
64 0.1
65 0.11
66 0.16
67 0.17
68 0.19
69 0.22
70 0.24
71 0.22
72 0.26
73 0.29
74 0.23
75 0.22
76 0.25
77 0.25
78 0.29
79 0.33
80 0.33
81 0.3
82 0.3
83 0.3
84 0.25
85 0.27
86 0.32
87 0.33
88 0.39